HCRLCHGKFSSRSLRSISDGERVFVRDFQRLLGVAVHQDPALSQFVCRNCHAQFYQCHSLLESFLQRVNVSPM
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ppp:A | 73 | 73 | 1.0000 | 1.0000 | 1.0000 | 2.71e-49 | |
2 | 7ppp:B | 61 | 73 | 0.8356 | 1.0000 | 0.8356 | 4.82e-37 | |
3 | 2lnw:A | 113 | 14 | 0.1370 | 0.0885 | 0.7143 | 0.96 | 7rnv:A, 4roj:A, 4roj:B, 4roj:C, 7wfy:C |
4 | 5jc3:A | 668 | 44 | 0.1781 | 0.0195 | 0.2955 | 2.5 | 5jc3:B, 5jc7:B, 5jcf:A, 5jcf:B, 5jch:A, 5jch:B |
5 | 3ogh:B | 151 | 25 | 0.1370 | 0.0662 | 0.4000 | 3.5 | 3ogh:A |
6 | 6tby:AAA | 320 | 47 | 0.2055 | 0.0469 | 0.3191 | 7.0 | 6tc5:AAA |
7 | 4d9n:A | 391 | 42 | 0.1644 | 0.0307 | 0.2857 | 7.1 | 4d9m:A, 4d9m:B, 4d9n:B |
8 | 1gth:A | 1019 | 20 | 0.1233 | 0.0088 | 0.4500 | 7.6 | 8f5w:A, 8f5w:B, 8f5w:C, 8f5w:D, 8f61:A, 8f61:B, 8f61:C, 8f61:D, 8f6n:A, 8f6n:B, 8f6n:C, 8f6n:D, 1gt8:A, 1gt8:B, 1gt8:C, 1gt8:D, 1gte:A, 1gte:B, 1gte:C, 1gte:D, 1gth:B, 1gth:C, 1gth:D, 1h7w:A, 1h7w:B, 1h7w:C, 1h7w:D, 1h7x:A, 1h7x:B, 1h7x:C, 1h7x:D, 7ljs:A, 7ljs:B, 7ljs:C, 7ljs:D, 7ljt:A, 7ljt:B, 7ljt:C, 7ljt:D, 7lju:A, 7lju:C, 7lju:D, 7lju:B, 7m31:A, 7m31:B, 7m31:C, 7m31:D, 7m32:A, 7m32:B, 7m32:C, 7m32:D |