BioLiP

>protein
HCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGA
HKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPD
SPFVVPVASPS

The query sequence (length=171) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4p3w:A	172	171	1.0000	0.9942	1.0000	2.38e-124	2brq:A, 2brq:B, 3isw:A, 3isw:B, 2jf1:A, 2mtp:A, 4p3w:B, 4p3w:E, 4p3w:F, 4p3w:D, 4p3w:C, 7sft:A, 2w0p:A, 2w0p:B
2	2k9u:A	119	104	0.5556	0.7983	0.9135	1.07e-64
3	2k9u:A	119	78	0.1345	0.1933	0.2949	0.14
4	2bp3:A	91	88	0.2632	0.4945	0.5114	1.40e-27	2bp3:B
5	2bp3:A	91	44	0.0936	0.1758	0.3636	0.001	2bp3:B
6	4mgx:A	181	84	0.2281	0.2155	0.4643	1.03e-16
7	4mgx:A	181	129	0.2339	0.2210	0.3101	2.85e-08
8	4mgx:A	181	55	0.0760	0.0718	0.2364	0.31
9	6fq3:A	390	65	0.1287	0.0564	0.3385	2.27e-05	6fql:A
10	6fq3:A	390	97	0.1871	0.0821	0.3299	2.34e-05	6fql:A
11	1k83:A	1366	102	0.1287	0.0161	0.2157	4.6	1twa:A, 1twc:A, 1twg:A, 1twh:A
12	7edd:A	1394	55	0.1053	0.0129	0.3273	8.7	5xyr:A
13	5kbk:A	157	31	0.0819	0.0892	0.4516	8.8	5kbl:A, 5kbm:A, 4n3t:A, 4n3u:A
14	5xya:A	1358	55	0.1053	0.0133	0.3273	8.9	5xxz:A
15	5xxz:B	1310	55	0.1053	0.0137	0.3273	9.1
16	7tz2:A	220	55	0.0936	0.0727	0.2909	9.2

[Back]