HAVVTVPTPRGAGPYYTQRCGETYAVYMEKDKAGPIENGVAKAGSELGCNPFLCRGYQYEDNEAVEYEPGQVIDFHVDLI
AGHHPGYANVSIVDLEANKIIGDPLRSWDDYPNRSDIDFNVTIPNTLGTACSTGGKCAIQWYWYASGNKQSYESCVDFYV
KA
The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ze9:CCC | 168 | 168 | 1.0000 | 0.9643 | 0.9643 | 3.92e-119 | 7ze9:AAA, 7ze9:BBB |
2 | 4v3b:A | 388 | 41 | 0.0617 | 0.0258 | 0.2439 | 3.9 | 4v3c:A |
3 | 8t3k:C | 541 | 30 | 0.0926 | 0.0277 | 0.5000 | 4.7 | |
4 | 7yca:B | 732 | 111 | 0.1667 | 0.0369 | 0.2432 | 6.1 | |
5 | 1jv1:A | 490 | 28 | 0.0741 | 0.0245 | 0.4286 | 8.8 | 1jv1:B, 1jv3:A, 1jv3:B, 1jvd:A, 1jvd:B, 1jvg:A, 1jvg:B, 6z2f:A, 6z2f:B |