BioLiP

>protein
HASKDPTTFPLGCSPDITTPKKGLSMELYSYDFRKKGSYPCWDAAYLDPNYPRTGYKSHRLLAKVDGVTGNINFYYHATK
GCTPQLGHLPASYNYPKPLTMTNFTMLLYGYFRPKVTGFHTFTISADDLLFVNFGAGNAFDCCRRDSSADHFGNYQAYAI
WGSKTAKDELTVHLDAGVYYPIRLFYNNRDYHGALSFTFKTESNENTVSDFSEYFFSLDDTEEGCPGLISY

The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6y9j:A	231	231	1.0000	1.0000	1.0000	6.32e-175	4a3x:A, 4af9:A, 4afa:A, 4afb:A, 4afc:A, 4asl:A, 4d3w:A
2	4coy:A	232	227	0.7792	0.7759	0.7930	1.30e-136	4cou:A, 4cov:A, 4cow:A, 4coz:A
3	6y98:A	225	218	0.4286	0.4400	0.4541	3.67e-60	4cp0:A, 4cp1:A, 4cp2:A
4	2xjp:A	258	125	0.1732	0.1550	0.3200	5.17e-12	4lhn:A, 2xjr:A, 2xjs:A, 2xjt:A, 2xju:A, 2xjv:A
5	4gq7:A	220	216	0.2468	0.2591	0.2639	6.64e-12	4lhk:A, 4lhk:B
6	6hos:A	213	190	0.2424	0.2629	0.2947	1.32e-11	6hos:B
7	5a3l:A	209	183	0.2208	0.2440	0.2787	7.68e-11	5a3l:B, 5a3l:C, 5a3l:D, 5a3m:A, 5a3m:B, 5a3m:C, 5a3m:D
8	3ijh:B	221	89	0.1082	0.1131	0.2809	1.9	3ijh:D, 3ijs:B, 3ijs:D, 3ijy:B, 3ijy:D, 3ikc:B, 3ikc:D
9	3oke:B	217	68	0.0909	0.0968	0.3088	6.2	3bpc:B, 4hgw:B, 2r1x:B, 2r1y:B, 2r2b:B, 2r2h:B, 7t0f:H
10	7k84:A	793	42	0.0606	0.0177	0.3333	10.0

[Back]