HAHLKSATPAADSTVAAPADLRLTFSEGVEATFTKVSLSKDGTEVAIKGLETPDADKKTLVVTPAAPLAAGNYKVVWNAV
SVDTHKSNGEYSFKVKK
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7bk5:AAA | 97 | 97 | 0.9691 | 0.9691 | 0.9691 | 1.54e-63 | 6nfq:A, 6nfq:B, 6nfq:C |
2 | 2c9p:A | 102 | 102 | 0.4845 | 0.4608 | 0.4608 | 2.38e-20 | 2c9p:B, 2c9p:C, 2c9q:A |
3 | 5icu:A | 102 | 96 | 0.3196 | 0.3039 | 0.3229 | 6.31e-09 | |
4 | 8ytq:D | 128 | 119 | 0.3711 | 0.2812 | 0.3025 | 5.47e-05 | 5n1t:W, 8ytq:A, 8ytq:C, 8ytr:A, 8ytr:B |
5 | 7aih:Ah | 452 | 54 | 0.1649 | 0.0354 | 0.2963 | 5.6 | 7ane:Ah |
6 | 1y0g:A | 169 | 20 | 0.1134 | 0.0651 | 0.5500 | 6.9 | 1y0g:B, 1y0g:C, 1y0g:D |
7 | 6w1n:B | 3719 | 38 | 0.1546 | 0.0040 | 0.3947 | 8.8 | 6w1n:D, 6w1n:F, 6w1n:H, 6x34:B, 6x34:D, 6x34:F, 6x34:H |
8 | 6x32:B | 3798 | 38 | 0.1546 | 0.0039 | 0.3947 | 8.8 | 6x32:E, 6x32:H, 6x32:K |
9 | 6x35:B | 3801 | 38 | 0.1546 | 0.0039 | 0.3947 | 8.8 | 6x35:E, 6x35:H, 6x35:K |
10 | 6x33:B | 3816 | 38 | 0.1546 | 0.0039 | 0.3947 | 8.8 | 8drp:A, 8drp:B, 8drp:C, 8drp:D, 6x33:E, 6x33:H, 6x33:K |