HAHLKSATPAADSTVAAPADLRLTFSAGVEATFTKVSLSKDGTEVAIKGLETPDADKKTLVVTPAAPLAAGNYKVVWNAV
SVDTHKSNGEYSFKVGQ
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7bk5:AAA | 97 | 97 | 1.0000 | 1.0000 | 1.0000 | 3.84e-66 | 6nfq:A, 6nfq:B, 6nfq:C |
2 | 2c9p:A | 102 | 101 | 0.4639 | 0.4412 | 0.4455 | 1.82e-18 | 2c9p:B, 2c9p:C, 2c9q:A |
3 | 5icu:A | 102 | 96 | 0.3196 | 0.3039 | 0.3229 | 2.73e-09 | |
4 | 8ytq:D | 128 | 119 | 0.3608 | 0.2734 | 0.2941 | 4.54e-04 | 5n1t:W, 8ytq:A, 8ytq:C, 8ytr:A, 8ytr:B |
5 | 7aih:Ah | 452 | 54 | 0.1649 | 0.0354 | 0.2963 | 3.0 | 7ane:Ah |
6 | 7olc:SC | 216 | 67 | 0.2371 | 0.1065 | 0.3433 | 4.5 | 7old:SC, 8oo0:SC, 7r81:D2, 7z3n:SC, 7z3o:SC |
7 | 6w1n:B | 3719 | 38 | 0.1546 | 0.0040 | 0.3947 | 5.7 | 6w1n:D, 6w1n:F, 6w1n:H, 6x34:B, 6x34:D, 6x34:F, 6x34:H |
8 | 6x32:B | 3798 | 38 | 0.1546 | 0.0039 | 0.3947 | 5.7 | 6x32:E, 6x32:H, 6x32:K |
9 | 6x35:B | 3801 | 38 | 0.1546 | 0.0039 | 0.3947 | 5.7 | 6x35:E, 6x35:H, 6x35:K |
10 | 6x33:B | 3816 | 38 | 0.1546 | 0.0039 | 0.3947 | 5.7 | 8drp:A, 8drp:B, 8drp:C, 8drp:D, 6x33:E, 6x33:H, 6x33:K |
11 | 1y0g:A | 169 | 20 | 0.1134 | 0.0651 | 0.5500 | 7.3 | 1y0g:B, 1y0g:C, 1y0g:D |
12 | 4v3p:LJ | 128 | 40 | 0.1340 | 0.1016 | 0.3250 | 8.2 | 4v7e:CK |