BioLiP

>protein
GYVGNAANGQLLYANATLDCTNCHGAMGDGLYKIDPHATVFGQNNKTLENIIAEDMPQLNPASCGAECAADIAAYIRTWA

The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8q1w:A	80	79	0.9875	0.9875	1.0000	5.49e-55	8q1w:B, 8q1w:C
2	7b21:AAA	92	91	0.4250	0.3696	0.3736	1.26e-10
3	5lo9:A	471	82	0.3250	0.0552	0.3171	0.12	5lo9:B
4	8snh:G	304	70	0.2500	0.0658	0.2857	0.59
5	8q1v:A	79	25	0.1250	0.1266	0.4000	1.3
6	1h31:A	261	13	0.1000	0.0307	0.6154	1.3	1h31:C, 1h31:E, 1h31:G, 1h32:A, 1h33:A, 2oz1:A, 2oz1:C, 2oz1:E, 2oz1:G
7	4n7c:A	174	57	0.2125	0.0977	0.2982	2.2
8	2xts:D	204	28	0.1375	0.0539	0.3929	4.9	2xts:B
9	5ysd:B	389	32	0.1750	0.0360	0.4375	5.4	5ysb:A, 5ysb:B, 5ysd:A, 5yse:A, 5yse:B, 5ysf:A, 5ysf:B
10	4qg5:A	565	18	0.1000	0.0142	0.4444	6.4	4qg5:B, 4qg5:C, 4qg5:D
11	6nlx:C	335	42	0.1875	0.0448	0.3571	6.6	6nlx:B, 6nlx:D, 5ur0:A, 5ur0:B, 5ur0:C, 5ur0:D
12	5afq:B	444	58	0.2000	0.0360	0.2759	7.1
13	1fd8:A	73	25	0.1000	0.1096	0.3200	7.5	3k7r:A, 3k7r:B, 3k7r:C, 3k7r:D, 3k7r:E, 3k7r:F, 3k7r:G, 3k7r:H, 3k7r:I, 3k7r:J, 3k7r:K, 3k7r:L, 5vde:B, 5vde:D, 5vdf:A, 5vdf:C, 5vdf:E, 5vdf:G, 5vdf:H
14	4jwf:A	187	33	0.1375	0.0588	0.3333	7.7	4jwf:B, 4jwh:A, 4jwh:B
15	6rwg:A	157	66	0.3000	0.1529	0.3636	9.3	1a1t:A, 1aaf:A, 1bj6:A, 2buo:A, 1esk:A, 2exf:A, 1f6u:A, 5i1r:A, 2jzw:A, 2l4l:A, 2m3z:A, 1mfs:A, 1q3y:A, 1q3z:A, 7r7p:I, 7r7p:L
16	6btm:E	161	38	0.1500	0.0745	0.3158	9.8

[Back]