GYDKDLCEWSMTADQTEVETQIEADIMNIVKRDRPEMKAEVQKQLKSGGVMQYNYVLYCDKNFNNKNIIAEVVGE
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7cn6:B | 75 | 75 | 1.0000 | 1.0000 | 1.0000 | 6.11e-52 | 7cn6:C |
2 | 4c3h:A | 1523 | 22 | 0.1600 | 0.0079 | 0.5455 | 2.9 | 4c2m:A, 4c2m:P, 4c3j:A |
3 | 1k1x:A | 636 | 65 | 0.2000 | 0.0236 | 0.2308 | 4.3 | 1k1w:A, 1k1x:B, 1k1y:A, 1k1y:B |
4 | 4nqr:A | 364 | 60 | 0.2667 | 0.0549 | 0.3333 | 6.6 | 4nqr:B, 4nv3:A, 4nv3:B, 4oat:A, 4oat:B, 4obb:A, 4obb:B, 4og2:A, 4og2:B, 4otz:A, 4otz:B, 4qym:A, 4qym:B, 4rdc:A, 4rv5:A, 4rv5:B |