BioLiP

>protein
GWTDPTEFPLGCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKVENVAGNINFYYHAPMG
CTSLFDTLPQAYNYRTPLTMTNFTMLLYGYFKPKVTGYHTFTISADDLLFVNFGAGNAFDCCKRESSADDFGNYQAYAVW
GSQTAKDDLTVHLDAGLYYPIRIFFNNRDNDGALSLTLKTESDPNPVIDFSDYFYSFDDTKDGCPGLVSYDT

The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4coy:A	232	232	1.0000	1.0000	1.0000	2.26e-174	4cou:A, 4cov:A, 4cow:A, 4coz:A
2	6y9j:A	231	227	0.7759	0.7792	0.7930	1.31e-136	4a3x:A, 4af9:A, 4afa:A, 4afb:A, 4afc:A, 4asl:A, 4d3w:A
3	6y98:A	225	219	0.4138	0.4267	0.4384	4.01e-55	4cp0:A, 4cp1:A, 4cp2:A
4	4gq7:A	220	223	0.2802	0.2955	0.2915	2.55e-13	4lhk:A, 4lhk:B
5	2xjp:A	258	130	0.1853	0.1667	0.3308	9.98e-13	4lhn:A, 2xjr:A, 2xjs:A, 2xjt:A, 2xju:A, 2xjv:A
6	6hos:A	213	179	0.2155	0.2347	0.2793	9.44e-12	6hos:B
7	5a3l:A	209	179	0.2241	0.2488	0.2905	6.78e-09	5a3l:B, 5a3l:C, 5a3l:D, 5a3m:A, 5a3m:B, 5a3m:C, 5a3m:D
8	4fln:B	464	43	0.0647	0.0323	0.3488	0.20	4fln:A, 4fln:C
9	4hcx:A	402	28	0.0474	0.0274	0.3929	1.2	4hcx:B
10	3bs1:A	103	42	0.0733	0.1650	0.4048	1.5	4xqj:A, 4xqj:D, 4xqn:A, 4xqn:J, 4xqn:D, 4xqn:G, 4xqq:B, 4xxe:A, 4xxe:D, 4xyq:A
11	3pmo:A	357	93	0.1250	0.0812	0.3118	6.1	6uec:A
12	6sxu:AAA	500	71	0.0905	0.0420	0.2958	7.8	1pz2:A, 1pz2:B, 1qw8:A, 1qw8:B, 1qw9:A, 1qw9:B, 6sxu:BBB, 6sxv:A, 6sxv:B
13	8ep4:A	265	69	0.0776	0.0679	0.2609	8.0	8ep4:B, 8ep4:C, 8ew1:A, 8ew1:B, 8ew1:C

[Back]