GVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPI
IGRTAAQCLEHYEFLLDKAAKAREKQLEEARRLAALQKRREKRKRGVDYNAEIPFEKKPALGFYDTSEADVDARKQAIRD
AERVKEMKRMHLQKSEELIKKEMITMLHYDLLHHKEELKKAQDVLVQEMEVVKQGMSHGESLEKRLEINRGHMTTEAKRA
AKMEKKMKILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYAD
LLLEKETLKS
The query sequence (length=330) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ch6:P | 330 | 330 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8i0t:L, 7qtt:P |
2 | 8i0u:L | 387 | 387 | 0.9879 | 0.8424 | 0.8424 | 0.0 | 8i0v:L |
3 | 6qdv:O | 441 | 437 | 0.9788 | 0.7324 | 0.7391 | 0.0 | 7w59:L, 7w5a:L, 7w5b:L |
4 | 8i0w:L | 419 | 416 | 0.8667 | 0.6826 | 0.6875 | 0.0 | 5yzg:L |
5 | 5z56:L | 342 | 364 | 0.8000 | 0.7719 | 0.7253 | 5.58e-175 | 5z57:L, 5z58:L |
6 | 6icz:L | 454 | 451 | 0.8606 | 0.6256 | 0.6297 | 4.54e-173 | 5xjc:L |
7 | 5mqf:L | 336 | 371 | 0.7788 | 0.7649 | 0.6927 | 1.69e-162 | |
8 | 6id0:L | 475 | 472 | 0.8303 | 0.5768 | 0.5805 | 6.11e-160 | 6id1:L |
9 | 8ro2:L | 555 | 559 | 0.8303 | 0.4937 | 0.4902 | 8.46e-132 | 7abi:L |
10 | 8i0s:L | 169 | 168 | 0.4485 | 0.8757 | 0.8810 | 1.37e-100 | |
11 | 9fmd:L | 555 | 282 | 0.5455 | 0.3243 | 0.6383 | 2.45e-99 | 8c6j:O, 7dvq:L, 6ff4:L, 8i0p:L, 8i0r:L, 6zym:L |
12 | 9fmd:L | 555 | 292 | 0.4970 | 0.2955 | 0.5616 | 1.16e-90 | 8c6j:O, 7dvq:L, 6ff4:L, 8i0p:L, 8i0r:L, 6zym:L |
13 | 3jb9:W | 426 | 173 | 0.3394 | 0.2629 | 0.6474 | 4.82e-67 | |
14 | 3jb9:W | 426 | 79 | 0.0667 | 0.0516 | 0.2785 | 1.8 | |
15 | 8ro1:L | 623 | 213 | 0.3424 | 0.1814 | 0.5305 | 3.53e-62 | 8ro0:L |
16 | 8ro1:L | 623 | 184 | 0.1818 | 0.0963 | 0.3261 | 2.20e-17 | 8ro0:L |
17 | 7dco:L | 435 | 170 | 0.2485 | 0.1885 | 0.4824 | 3.91e-45 | |
18 | 5gm6:c | 415 | 175 | 0.2455 | 0.1952 | 0.4629 | 5.33e-45 | |
19 | 7b9v:O | 280 | 190 | 0.2455 | 0.2893 | 0.4263 | 2.15e-44 | |
20 | 5lj5:O | 283 | 190 | 0.2485 | 0.2898 | 0.4316 | 7.08e-43 | |
21 | 6j6g:c | 436 | 191 | 0.2424 | 0.1835 | 0.4188 | 1.08e-41 | 6j6h:c, 6j6n:c, 6j6q:c, 5y88:J, 5ylz:J |
22 | 5gmk:c | 436 | 196 | 0.2455 | 0.1858 | 0.4133 | 1.52e-41 | 5lj3:O, 5mps:O, 5mq0:O, 5wsg:c |
23 | 6exn:O | 320 | 209 | 0.2485 | 0.2562 | 0.3923 | 3.64e-40 | 6bk8:S |
24 | 3zqc:J | 119 | 85 | 0.0939 | 0.2605 | 0.3647 | 8.61e-13 | 3zqc:A, 3zqc:D, 3zqc:G |
25 | 6kks:A | 106 | 100 | 0.1030 | 0.3208 | 0.3400 | 2.21e-12 | |
26 | 1h88:C | 152 | 97 | 0.1030 | 0.2237 | 0.3505 | 7.01e-12 | 1h89:C, 1h8a:C, 1mse:C, 1msf:C |
27 | 1h88:C | 152 | 119 | 0.1212 | 0.2632 | 0.3361 | 1.12e-11 | 1h89:C, 1h8a:C, 1mse:C, 1msf:C |
28 | 1h88:C | 152 | 75 | 0.0788 | 0.1711 | 0.3467 | 0.23 | 1h89:C, 1h8a:C, 1mse:C, 1msf:C |
29 | 3osg:A | 110 | 79 | 0.0970 | 0.2909 | 0.4051 | 2.08e-10 | 3osf:A, 3osf:D, 3osg:D |
30 | 2kdz:A | 107 | 54 | 0.0606 | 0.1869 | 0.3704 | 6.37e-08 | |
31 | 7zwc:c | 303 | 99 | 0.1121 | 0.1221 | 0.3737 | 6.90e-06 | 7zwd:c, 7zx7:c, 7zx8:c, 7zxe:c |
32 | 7zwc:c | 303 | 104 | 0.0879 | 0.0957 | 0.2788 | 0.18 | 7zwd:c, 7zx7:c, 7zx8:c, 7zxe:c |
33 | 5eyb:A | 340 | 104 | 0.1061 | 0.1029 | 0.3365 | 1.40e-05 | 5eyb:B |
34 | 8ity:4 | 365 | 99 | 0.1121 | 0.1014 | 0.3737 | 2.23e-05 | 8iue:4, 8iuh:4 |
35 | 8ity:4 | 365 | 95 | 0.1000 | 0.0904 | 0.3474 | 2.69e-05 | 8iue:4, 8iuh:4 |
36 | 8ity:4 | 365 | 100 | 0.1000 | 0.0904 | 0.3300 | 5.21e-05 | 8iue:4, 8iuh:4 |
37 | 8ity:4 | 365 | 106 | 0.0909 | 0.0822 | 0.2830 | 0.20 | 8iue:4, 8iuh:4 |
38 | 7xur:A | 307 | 129 | 0.1333 | 0.1433 | 0.3411 | 2.67e-05 | |
39 | 7xur:A | 307 | 95 | 0.1000 | 0.1075 | 0.3474 | 5.79e-05 | |
40 | 7xur:A | 307 | 100 | 0.1000 | 0.1075 | 0.3300 | 1.04e-04 | |
41 | 7xur:A | 307 | 106 | 0.0909 | 0.0977 | 0.2830 | 0.36 | |
42 | 4a69:C | 69 | 43 | 0.0424 | 0.2029 | 0.3256 | 0.65 | 4a69:D |
43 | 8ox1:M | 65 | 45 | 0.0545 | 0.2769 | 0.4000 | 0.80 | 1iv6:A, 8ox1:L, 1w0t:A, 1w0t:B |
44 | 6e9f:A | 864 | 76 | 0.0818 | 0.0312 | 0.3553 | 0.82 | 6e9e:A |
45 | 7c4p:A | 55 | 43 | 0.0485 | 0.2909 | 0.3721 | 0.91 | 7c4p:B, 7c4q:A, 7c4q:B, 7c4r:A, 7c4r:B |
46 | 8asw:A | 1255 | 188 | 0.1394 | 0.0367 | 0.2447 | 3.8 | |
47 | 5b2r:B | 1319 | 50 | 0.0485 | 0.0121 | 0.3200 | 4.0 | 5b2s:B, 5fq5:B, 5fw1:B, 8g1i:A, 6k3z:B, 6k4s:B, 6k4u:B, 6k57:B, 7qqw:B, 4un3:B, 4un4:B, 4un5:B, 8wus:A, 8wut:A, 8wuu:A |
48 | 8t7s:A | 1312 | 50 | 0.0485 | 0.0122 | 0.3200 | 4.0 | |
49 | 8t6x:A | 1278 | 50 | 0.0485 | 0.0125 | 0.3200 | 4.2 | |
50 | 7s4v:A | 1122 | 50 | 0.0485 | 0.0143 | 0.3200 | 4.5 | 6o0x:A, 8t6p:A |
51 | 9ax8:z | 509 | 47 | 0.0455 | 0.0295 | 0.3191 | 4.6 | 3jcj:f, 3jcn:b, 5me0:W, 5me1:W, 6o7k:f, 6o9k:z |
52 | 6o0y:A | 1146 | 50 | 0.0485 | 0.0140 | 0.3200 | 4.8 | |
53 | 8t6t:A | 1168 | 50 | 0.0485 | 0.0137 | 0.3200 | 4.8 | 8t7s:G |
54 | 6k8n:A | 668 | 62 | 0.0545 | 0.0269 | 0.2903 | 6.7 | 6k8n:B, 6k8n:C, 6k8n:D, 6k8o:A |
55 | 1vfc:A | 63 | 42 | 0.0455 | 0.2381 | 0.3571 | 8.2 | 3sjm:A, 3sjm:B, 1w0u:A, 1w0u:B |
56 | 6ecv:A | 286 | 62 | 0.0515 | 0.0594 | 0.2742 | 9.5 | 6ecu:A, 6ecu:B, 6ecv:B, 6ecw:A, 6ecw:B |