BioLiP

>protein
GVTPVAVMTKPLPCPGKCIYCPTFAATPQSYTPESPAVLRAKSCEYQAYKQVALRLRIIQDMGHPTDKVELIIMGGTFLS
ADITYQYGFIKDCYDALNGVVAGSLEEAKTINETAQHRCVGLCIETRPDICGKAEIQRMIDFGTTRVELGVQMLDDDIYK
LVERGHRVSDVAEATCLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVFEDPRFCPDGLKLYPTMVVEGTILEQWWKEGR
YTPYPNGTMTGLIADIKALVPPYVRISRVRCIREPTLRRLDYPASGGKEIFLSFEDASDTLYGLLRLRIPCASLPVLGQK
YGAKTGLVRALHVGGRGLGRKLLAEAECLARDEFGLDSLAILSGVGAREYYRSLGYELVAGYMCKHLD

The query sequence (length=388) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5l7j:A	406	403	0.9948	0.9507	0.9578	0.0	6ia6:A, 5l7l:A
2	8asw:C	527	449	0.4330	0.3188	0.3742	1.70e-91	8asv:C, 6qk7:C
3	8pty:C	440	440	0.4459	0.3932	0.3932	1.50e-88	8avg:C
4	8ptx:C	538	463	0.4485	0.3234	0.3758	3.65e-84	8ptz:C, 8pu0:C
5	6fd2:A	454	128	0.0747	0.0639	0.2266	0.39	6fd2:B
6	1ghe:B	171	46	0.0490	0.1111	0.4130	1.4	1ghe:A, 1j4j:A, 1j4j:B
7	8cff:A	823	37	0.0309	0.0146	0.3243	2.6	8cff:C, 8cff:E, 8cff:G, 8cgs:A, 8cgs:C, 8cgs:E, 8cgs:G, 8ch9:A, 8ch9:C, 8ch9:E, 8ch9:G, 1g8j:A, 1g8j:C, 1g8k:A, 1g8k:C, 1g8k:E, 1g8k:G
8	5jph:B	144	44	0.0387	0.1042	0.3409	3.3	5jph:A, 5jph:C
9	2p51:A	255	63	0.0412	0.0627	0.2540	3.7	3g0z:A, 3g10:A
10	3bow:A	680	75	0.0515	0.0294	0.2667	4.3	3df0:A, 1mdw:A, 1mdw:B
11	8r34:A	485	23	0.0309	0.0247	0.5217	4.6	8r34:B
12	4efc:A	452	61	0.0412	0.0354	0.2623	5.6	4efc:B
13	3hng:A	288	123	0.0619	0.0833	0.1951	5.9

[Back]