GVSIRSMKNFYDWIKEFVRDQGEFIAQQSGWLELERSSYAKLIAQTISHVLNGGSLLVSADSSRHWFLNYILSNLNPKDL
KERPLLSVIDFNASSFYPKNDANLSLATIEMTYQNPMFWHVGKIENEGLKTILLSKIPSFLWLFEELKEDCLLLKEHDSL
LDYKLLQLFKLFENALFSVLYNKVTL
The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2uvp:C | 186 | 186 | 1.0000 | 1.0000 | 1.0000 | 8.13e-136 | 2uvp:B |
2 | 7uny:C | 127 | 78 | 0.0968 | 0.1417 | 0.2308 | 0.63 | 7uny:B |
3 | 8om5:A | 828 | 78 | 0.1022 | 0.0229 | 0.2436 | 0.96 | 8omo:A |
4 | 8ag6:A | 896 | 78 | 0.1022 | 0.0212 | 0.2436 | 1.1 | 2o8b:A, 2o8c:A, 2o8d:A, 2o8e:A, 2o8f:A, 8olx:A, 8om9:A, 8oma:A, 8omq:A, 3thw:A, 3thx:A, 3thy:A, 3thz:A |
5 | 3rmp:A | 77 | 19 | 0.0538 | 0.1299 | 0.5263 | 3.1 | 3rmp:C |
6 | 9fp6:A | 732 | 53 | 0.0699 | 0.0178 | 0.2453 | 4.4 | 9fp6:B, 9fp6:C, 9fp6:D, 9fp6:E, 9fp6:F |
7 | 2es2:A | 67 | 32 | 0.0645 | 0.1791 | 0.3750 | 4.9 | 3pf4:B, 3pf5:B, 3pf5:A |