BioLiP

>protein
GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQI
AQLIAGYIDIIL

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6mfs:A	370	92	1.0000	0.2486	1.0000	8.27e-62	2g35:A, 2k00:A, 1mk7:B, 1mk7:D, 1mk9:B, 1mk9:D, 1mk9:F, 1mk9:H, 2mwn:B, 1y19:B, 1y19:D, 1y19:F, 1y19:H, 1y19:J, 1y19:L
2	8tec:A	448	70	0.2065	0.0424	0.2714	0.001	8tee:A, 8tee:B
3	3n91:A	315	58	0.1848	0.0540	0.2931	2.8
4	2c2c:A	112	57	0.1630	0.1339	0.2632	3.4	3c2c:A
5	7txl:A	275	45	0.1630	0.0545	0.3333	3.6	7txk:A, 7txk:B, 7txl:B
6	3tto:A	1055	31	0.1304	0.0114	0.3871	5.3	3tto:B, 3tto:C, 3tto:D, 3ttq:A, 4ttu:A, 4tvc:A, 4tvd:A
7	5jb3:S	67	46	0.1522	0.2090	0.3043	5.3	5jbh:S, 6sw9:S, 6swc:S, 6swe:S, 4v4n:BS, 4v6u:AS, 7zag:S, 7zah:S, 7zai:S, 7zhg:S
8	7zaz:CCC	690	15	0.0761	0.0101	0.4667	8.4
9	8h3m:C	930	21	0.1196	0.0118	0.5238	8.9
10	7xu5:B	938	21	0.1196	0.0117	0.5238	8.9	7xu5:A, 7xu5:C
11	7q9f:A	1009	21	0.1196	0.0109	0.5238	8.9	7akd:C, 7l56:B, 7l56:C, 7l56:A, 7q9f:B
12	7od3:A	1012	21	0.1196	0.0109	0.5238	8.9	7od3:B, 7od3:C
13	7tei:B	1042	21	0.1196	0.0106	0.5238	8.9
14	7wuh:E	1044	21	0.1196	0.0105	0.5238	8.9	7wuh:A, 7xu3:B, 7xu3:A, 7xu3:C, 6zb5:A, 6zb5:C, 6zb5:B
15	8xus:B	1063	21	0.1196	0.0103	0.5238	8.9	8if2:B
16	8bon:B	1070	21	0.1196	0.0103	0.5238	8.9	8bon:A, 8bon:C, 7nd7:A, 7nd7:B, 7nd7:C, 8xut:B, 8xut:A
17	8hlc:A	1081	21	0.1196	0.0102	0.5238	8.9	7e7d:A, 7e7d:B, 7e7d:C, 8h3e:A, 8h3e:B, 8h3e:C, 8hlc:B, 8hlc:C, 7odl:A, 7odl:B, 7odl:C, 7wgx:A, 7wgx:B, 7wgx:C, 6zb4:C, 6zb4:B, 6zb4:A, 6zoz:A, 6zoz:B, 6zoz:C
18	8cya:A	1100	21	0.1196	0.0100	0.5238	8.9	7nt9:A, 7nt9:B, 7nt9:C, 7nta:B, 7nta:C, 7nta:A, 7ntc:A, 7ntc:B, 8p9y:C
19	7jji:A	1109	21	0.1196	0.0099	0.5238	8.9	8aaa:A, 7b62:A, 7beh:E, 7bem:E, 8bec:B, 8bec:D, 7d2z:B, 7d30:B, 7dwy:A, 7dwy:B, 7dwy:C, 7e7b:A, 7e7b:B, 7e7b:C, 7f5g:C, 8j1q:C, 8j26:C, 7jji:C, 7jji:B, 7kmh:C, 7l2c:B, 7l4z:B, 7l4z:D, 7l4z:A, 7l4z:C, 7l4z:E, 7ldj:A, 7ly3:A, 7ly3:B, 7q0i:D, 8qh0:A, 7qur:A, 7qur:B, 7qur:C, 7qus:A, 7qus:B, 7qus:C, 7r6w:R, 7sn0:C, 7wd8:B, 7wgv:A, 7wgv:B, 7wgv:C, 7wk8:A, 7x08:A, 7x08:B, 7x08:C, 7x2l:E, 7x93:G, 7xtz:A, 7xtz:C, 7xtz:B, 7xu0:C, 7xu0:B, 7xu1:A, 7xu6:A, 7xu6:C, 7xu6:B, 7xwa:D, 7y0c:E, 7y0c:R, 7yck:A, 7z8o:A, 7zbu:A, 6zp2:A, 6zp2:C, 6zp2:B

[Back]