GVLKVYLDYRRKNFNFLHNSTKMFLDNLERVLIVTGFPIPPMMVAETDGPPGALAIYRAVEMLGGKAEILTYSEVEKALE
PFGVSLARTPEPEDYSLIISVETPGRAADGRYYSMSALEIKRDPLDGIFLKARALGIPTIGVGDGGNEIGMGKIRELVVG
HVPHGEKIASVVETDELIVSAVSNWGAYGLVAQASIEVGRNLLEGWDERRVIEAISSAGLIDGVSKTLAPSVDGIRLMVH
EGIVELLKAVVDEAIL
The query sequence (length=256) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4dwz:C | 269 | 256 | 1.0000 | 0.9517 | 1.0000 | 0.0 | 4dwz:A, 4dwz:B, 4dwz:D, 4dwz:E, 4dwz:F, 4fc5:A, 4fc5:B, 4fc5:C, 4fc5:D, 4fc5:E, 4fc5:F, 5gl2:A, 5gl2:B, 5gl2:C, 5gl2:D, 5gl2:E, 5gl2:F, 5gl3:A, 5gl3:B, 5gl3:C, 5gl3:D, 5gl3:E, 5gl3:F, 5gl4:A, 5gl4:B, 5gl4:C, 5gl4:D, 5gl4:F, 5gl4:E |
2 | 2doq:B | 149 | 77 | 0.0977 | 0.1678 | 0.3247 | 0.55 | 2doq:A, 2doq:C, 4mbe:D, 4mbe:A |
3 | 6lcp:A | 1140 | 84 | 0.0898 | 0.0202 | 0.2738 | 2.7 | 6lcr:A |
4 | 6v8o:D | 100 | 37 | 0.0547 | 0.1400 | 0.3784 | 3.6 | 6v92:D |
5 | 7qlr:A | 603 | 106 | 0.0859 | 0.0365 | 0.2075 | 6.7 | 7qlr:B, 7qlr:C, 7qlr:D |