GVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKKLAEQAAAIVC
LRSQGLPEGR
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5oc6:A | 90 | 90 | 1.0000 | 1.0000 | 1.0000 | 6.20e-63 | |
| 2 | 3adi:A | 71 | 64 | 0.2889 | 0.3662 | 0.4062 | 2.23e-04 | |
| 3 | 2b7h:A | 141 | 57 | 0.2111 | 0.1348 | 0.3333 | 1.6 | 2b7h:C, 1fhj:A, 1fhj:C, 3gou:A, 3gou:C, 3pel:A, 2qls:A, 2qls:C |
| 4 | 3d4x:A | 141 | 62 | 0.2222 | 0.1418 | 0.3226 | 1.7 | 3d4x:C, 3gqp:A, 3gqp:C, 3gqr:A, 3gqr:C, 3gqr:E, 3gqr:G, 3gys:A, 3gys:C, 3gys:E, 3gys:G |
| 5 | 7uab:A | 481 | 38 | 0.1111 | 0.0208 | 0.2632 | 1.8 | 7uab:D |
| 6 | 7uac:H | 546 | 38 | 0.1111 | 0.0183 | 0.2632 | 1.8 | 7uab:E, 7uab:H, 7uae:A, 7uaf:B, 7uaf:A, 7uaf:C, 7uaf:D, 7uai:E, 7uai:B, 7uai:C, 7uai:D |
| 7 | 4yu3:A | 141 | 57 | 0.2222 | 0.1418 | 0.3509 | 1.9 | 4yu4:A, 4yu4:C |
| 8 | 8eo6:A | 268 | 48 | 0.1556 | 0.0522 | 0.2917 | 4.9 | 8eo6:B |
| 9 | 6lla:B | 363 | 22 | 0.1000 | 0.0248 | 0.4091 | 6.4 | 6lk2:A, 6lk2:B, 6lk2:C, 6lk2:D, 6lla:A, 6lla:C, 6lla:D |
| 10 | 3nwa:A | 608 | 47 | 0.1556 | 0.0230 | 0.2979 | 8.1 | 4hsi:C, 3nw8:B, 3nw8:A, 3nw8:C, 3nwa:B, 3nwa:C, 3nwa:D, 3nwd:C, 3nwf:A, 3nwf:B |
| 11 | 8ctn:B | 96 | 25 | 0.1222 | 0.1146 | 0.4400 | 9.7 | 8cts:B, 8ctu:B, 8cu2:B, 8cu3:B, 8cu4:B, 6dz1:B, 6fiz:C, 6fiz:D, 6fiz:E, 6fiz:G, 6fiz:H, 6fiz:J, 6fiz:L, 6fiz:N, 6fiz:A, 6fiz:O, 6fiz:P, 4r50:B, 4r6z:A, 4r6z:B, 4r7c:C, 4r8c:A, 4ro2:A, 4ro2:B, 4ro2:D |
umich.edu