GVHRVGYTHPSTLPVPCAQRWDLRLARARIFQEYIEEKAPGAWQLEDERSMSPEFKTFTGYPMRDMRPGYGQNLPDYIMK
KRLPNNTHYELFARRDIPNEDNAMYGKYLYDMTVHGTSLPSTYRMHKDINKAQRNDRKLSGNRFKVL
The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ane:s | 165 | 147 | 0.9184 | 0.8182 | 0.9184 | 5.70e-103 | 7aor:s, 6hiv:Ci, 6hiw:Ci, 6hiz:Ci, 7pua:Ci, 7pub:Ci, 6sg9:Ci, 6sgb:Ci |
2 | 1rrv:A | 401 | 43 | 0.0884 | 0.0324 | 0.3023 | 0.38 | 1rrv:B |
3 | 8ea6:B | 124 | 67 | 0.1224 | 0.1452 | 0.2687 | 0.79 | 8ea5:A, 8ea5:B, 8ea6:A, 8ea7:A, 8ea7:B, 8ea8:B, 8ea8:A, 8ea9:B, 8ea9:A, 8eaa:B, 8eaa:A, 8eab:A, 8eab:B, 8se5:B, 8se5:A, 8se6:A, 8se6:B |
4 | 1pn3:A | 391 | 33 | 0.0816 | 0.0307 | 0.3636 | 1.8 | 1pn3:B, 1pnv:B, 1pnv:A |
5 | 3ndz:A | 345 | 59 | 0.1224 | 0.0522 | 0.3051 | 4.7 | 3ndz:C, 3ndz:B, 3ndz:D |
6 | 8urb:A | 921 | 34 | 0.0952 | 0.0152 | 0.4118 | 5.2 | 8g6r:A |
7 | 7l56:F | 129 | 48 | 0.1156 | 0.1318 | 0.3542 | 9.9 | 7l56:H |