BioLiP

>protein
GVDAMYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYR

The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2pf4:E	163	80	0.9625	0.4724	0.9625	3.60e-54	2pf4:F, 2pkg:C, 2pkg:D
2	2pf4:H	143	78	0.9375	0.5245	0.9615	6.78e-53	2pf4:G
3	7aor:j	180	47	0.1625	0.0722	0.2766	1.3
4	7dry:A	186	36	0.1500	0.0645	0.3333	1.5	7drz:A, 7ds0:A, 7ds1:A
5	6hiv:CP	180	47	0.1625	0.0722	0.2766	1.5	6hiw:CP, 6hiy:CP, 7pua:CP, 7pub:CP, 6sga:CP, 6sgb:CP
6	2bf4:A	645	41	0.1625	0.0202	0.3171	1.6	2bf4:B, 2bn4:A, 2bn4:B, 2bpo:A, 2bpo:B
7	8es8:B	287	27	0.1375	0.0383	0.4074	2.5	6avf:B, 4eup:H, 4eup:J, 1fyt:E, 1j8h:E, 6tro:E
8	7ow5:E	246	34	0.1500	0.0488	0.3529	3.3	4jrx:E, 5l2k:E, 7ow6:E, 7pb2:E, 7pb2:J, 7pbc:BBB, 7pdw:BBB, 7pdw:GGG, 3sjv:E, 3sjv:J, 3sjv:O, 3sjv:T
9	7ane:j	180	53	0.1750	0.0778	0.2642	4.4
10	3mff:D	242	38	0.1625	0.0537	0.3421	6.8	7n5c:E, 3pqy:E, 3pqy:J, 3pqy:O, 3pqy:T
11	7o1o:A	356	20	0.1250	0.0281	0.5000	8.3	3ciw:A, 3cix:A, 5fep:A, 5fes:A, 5few:A, 5fex:A, 5fez:A, 5ff0:A, 5ff2:A, 5ff3:A, 5ff4:A, 3iix:A, 3iiz:A, 4jxc:A, 4jy8:A, 4jy9:A, 4jyd:A, 4jye:A, 4jyf:A, 7o1p:A, 7o1s:A, 7o1t:A, 7o25:A, 7o26:A, 8qmk:A, 8qml:A, 8qmm:A, 8qmn:A
12	8iwo:A	956	18	0.1125	0.0094	0.5000	9.2	8iwo:B, 8j2m:A, 8j2m:B

[Back]