GTVDLDAPVQKDTAMSLVSSFENSSTDWQAQYGYLEDIAAGRGYTGGLIGFTSGTGDMLELVRAYSASSPGNPLEQYIPA
LEAVNGTDSHAGLGQGFEQAWADAAETSEFRAAQDAERDRVYFDPAVAQGKADGLSALGQFAYYDTLVVHGPGSQRDAFG
GIRAEALSAALPPSQGGDETEYLEAFFDARNVIMREEPAHADTSRIDTAQRVFLQNGNFDLERPLTWSVYGDQYSLN
The query sequence (length=237) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4olt:B | 237 | 237 | 0.9958 | 0.9958 | 0.9958 | 6.94e-174 | 4olt:A, 4qwp:A, 4qwp:B |
2 | 7c6d:A | 241 | 229 | 0.3671 | 0.3610 | 0.3799 | 5.73e-39 | |
3 | 6lwu:A | 242 | 239 | 0.3544 | 0.3471 | 0.3515 | 3.58e-36 | 6x2q:A |
4 | 5hwa:A | 259 | 201 | 0.2194 | 0.2008 | 0.2587 | 2.63e-06 | |
5 | 5z2v:B | 197 | 62 | 0.0886 | 0.1066 | 0.3387 | 3.5 | 5z2v:A |
6 | 8fxi:C | 630 | 79 | 0.1097 | 0.0413 | 0.3291 | 3.5 | 8fxi:D |
7 | 5t8s:A | 388 | 52 | 0.0717 | 0.0438 | 0.3269 | 8.2 | 5t8s:B, 5t8t:A, 5t8t:B |
8 | 5eu6:E | 244 | 68 | 0.0886 | 0.0861 | 0.3088 | 8.9 | 8dnt:B, 8dnt:I, 8dnt:P, 8dnt:W, 4mji:E, 4mji:J, 4ozf:H, 4ozg:F, 4ozg:H, 4ozh:F, 4ozh:H, 6px6:E, 7sg0:E, 6u3o:H, 6u3o:B |