GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFS
DWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQ
ALPPA
The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ao2:A | 165 | 165 | 1.0000 | 1.0000 | 1.0000 | 8.42e-119 | 2ao2:B, 2ao2:C, 2fp2:B |
2 | 8pnh:A | 386 | 152 | 0.2727 | 0.1166 | 0.2961 | 1.13e-09 | |
3 | 8pnj:A | 390 | 72 | 0.1455 | 0.0615 | 0.3333 | 5.20e-04 | |
4 | 1ecm:B | 95 | 58 | 0.1152 | 0.2000 | 0.3276 | 0.002 | 1ecm:A |
5 | 6h2j:B | 990 | 65 | 0.1091 | 0.0182 | 0.2769 | 1.4 | 4be7:B, 4be7:D, 4beb:A, 4beb:B, 4beb:C, 4beb:D, 4bec:A, 4bec:B, 6h2j:A, 2w00:A, 2w00:B, 4xjx:A, 4xjx:B |
6 | 6j9f:C | 1296 | 35 | 0.0848 | 0.0108 | 0.4000 | 2.4 | |
7 | 6j9e:C | 1288 | 35 | 0.0848 | 0.0109 | 0.4000 | 2.5 | |
8 | 8ovh:A | 400 | 44 | 0.0909 | 0.0375 | 0.3409 | 3.6 | 8ovh:B, 8ovh:C, 8ovh:D |
9 | 3uvf:A | 255 | 125 | 0.1455 | 0.0941 | 0.1920 | 5.6 | 3uvf:B |
10 | 6r7u:B | 308 | 29 | 0.0788 | 0.0422 | 0.4483 | 5.9 | 7od0:AAA, 7od0:BBB, 7od0:CCC, 7od0:DDD, 7od0:EEE, 7od0:FFF, 6r7u:A, 6r7v:A, 6r7w:A |
11 | 2q3p:A | 103 | 32 | 0.0545 | 0.0874 | 0.2812 | 8.4 | 1q4r:A |