BioLiP

>protein
GTRGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYN

The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2l8e:A	49	49	1.0000	1.0000	1.0000	1.19e-31
2	2cw6:A	296	26	0.2449	0.0405	0.4615	0.33	2cw6:B, 2cw6:C, 2cw6:D, 2cw6:E, 2cw6:F, 3mp3:A, 3mp3:B, 3mp3:C, 3mp3:D, 3mp3:E, 3mp3:F, 3mp5:B, 3mp5:C
3	8i3q:A	595	27	0.2245	0.0185	0.4074	2.7
4	6xmg:A	638	27	0.2245	0.0172	0.4074	3.3	6xmf:A
5	2czr:A	226	19	0.1837	0.0398	0.4737	5.4
6	5hqm:A	459	32	0.2653	0.0283	0.4062	6.5	5han:A, 5han:B, 5han:C, 5han:D, 5han:E, 5han:F, 5han:G, 5han:H, 5han:I, 5han:J, 5han:K, 5han:L, 5hao:A, 5hao:B, 5hao:C, 5hao:D, 5hao:E, 5hao:F, 5hat:A, 5hat:B, 5hat:C, 5hat:D, 5hat:E, 5hat:F, 5hat:G, 5hat:H, 5hat:I, 5hat:J, 5hat:K, 5hat:L, 5hjx:A, 5hjx:B, 5hjx:C, 5hjx:D, 5hjx:E, 5hjx:F, 5hjy:A, 5hjy:B, 5hjy:C, 5hjy:D, 5hjy:E, 5hjy:F, 5hk4:A, 5hk4:B, 5hk4:C, 5hk4:D, 5hk4:E, 5hk4:F, 5hql:A, 5hql:B, 5hql:C, 5hql:D, 5hql:E, 5hql:F, 5hqm:B, 5koz:A, 5koz:B, 5koz:C, 5koz:D, 5koz:E, 5koz:F, 5koz:G, 5koz:H, 5koz:I, 5koz:J, 5koz:K, 5koz:L, 4lf1:A, 4lf1:B, 4lf1:C, 4lf1:D, 4lf1:E, 4lf1:F, 4lf2:A, 4lf2:C, 4lf2:D
7	4fai:B	305	43	0.2857	0.0459	0.3256	6.7	4fai:A, 4fbe:A, 4fbe:B
8	7t1j:B	457	22	0.2041	0.0219	0.4545	8.6	7t1j:A, 7t1j:C, 7t1j:D, 7t1j:E, 7t1j:F, 7t1j:G, 7t1j:H, 7t1j:I, 7t1j:J, 7t1j:K, 7t1j:L
9	4yj0:B	63	27	0.2245	0.1746	0.4074	9.4	4yj0:A, 4yj0:C
10	8c0z:A	616	37	0.2653	0.0211	0.3514	9.7	8c0z:B

[Back]