GTLGARRGLEWFLGFYFLSHIPITLLMDLQGVLPRDLYPVELRNLQQWYIEEFKDPLLQTPPAWFKSFLFCELVFQLPFF
PIAAYAFFKGGCKWIRTPAIIYSVHTMTTLIPILSTLLLDDFSKRGQGPKTFQERLFLISVYIPYFLIPLILLLFMVRNP
YYK
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7m95:B | 167 | 167 | 1.0000 | 0.9760 | 0.9760 | 5.35e-115 | 7m93:A, 7m93:B, 7m93:C, 7m93:D, 7m94:A, 7m94:B, 7m94:C, 7m94:D, 7m95:A, 7m96:A, 7m96:B, 7m96:C, 7m96:D, 7mfi:A, 7mfi:B, 7mfi:C, 7mfi:D |
2 | 7zvr:A | 235 | 48 | 0.0982 | 0.0681 | 0.3333 | 0.73 | |
3 | 3knt:A | 207 | 36 | 0.0675 | 0.0531 | 0.3056 | 2.9 | 3knt:C, 3knt:B, 3knt:D |
4 | 6c6r:A | 451 | 58 | 0.0982 | 0.0355 | 0.2759 | 8.4 | 6c6n:A, 6c6n:B, 6c6p:A, 6c6p:B, 6c6r:B |
5 | 5ah0:B | 387 | 45 | 0.0859 | 0.0362 | 0.3111 | 8.7 | 5ah0:A |