BioLiP

>protein
GTLDAPFPEYQTLPADPMSVLHNWLERARRVGIREPRALALATADSQGRPSTRIVVISEISDAGVVFSTHAGSQKGRELL
HNPWASGVLYWRETSQQIILNGQAVRLPNAKADDAWLKRPYATHPMSSVSRQSEELQDVQAMRNAARQLAELQGPLPRPE
GYCVFELRLESLEFWGNGQERLHERLRYDRSDTGWNVRRLQP

The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4hmt:B	207	202	1.0000	0.9758	1.0000	5.59e-150	4hms:A, 4hms:B, 4hmt:A, 4hmu:A, 4hmu:B, 4hmv:A, 4hmv:B, 1ty9:A, 1ty9:B
2	1t9m:A	204	202	0.7277	0.7206	0.7277	6.80e-108	1t9m:B
3	4hmw:B	205	202	0.4802	0.4732	0.4802	3.71e-64	4hmw:A, 4hmx:A, 4hmx:B
4	1jnw:A	214	192	0.3069	0.2897	0.3229	4.29e-34	1dnl:A, 1g76:A, 1g77:A, 1g78:A, 1g79:A, 6ylz:AAA, 6ymh:BBB
5	1nrg:A	213	178	0.2772	0.2629	0.3146	1.56e-25	6h00:A, 3hy8:A, 8qyt:A, 8qyw:A
6	1wv4:A	162	190	0.2574	0.3210	0.2737	7.65e-24	1wv4:B, 6ymh:AAA
7	1ci0:A	205	201	0.2475	0.2439	0.2488	1.07e-13	1ci0:B
8	2i51:A	194	68	0.1089	0.1134	0.3235	0.015	2i51:B
9	9fgp:A	140	60	0.0842	0.1214	0.2833	1.1	9fgp:B
10	6z7n:B	847	80	0.1089	0.0260	0.2750	2.3
11	3lpp:B	869	44	0.0792	0.0184	0.3636	3.7	3lpp:D
12	7q9f:A	1009	61	0.0941	0.0188	0.3115	3.9	7akd:C, 7l56:B, 7l56:C, 7l56:A, 7q9f:B
13	5ue8:A	847	18	0.0446	0.0106	0.5000	8.7	5ue8:B, 1y8f:A

[Back]