GTKQEKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYRSALARF
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1f4n:A | 59 | 56 | 1.0000 | 0.9492 | 1.0000 | 4.76e-35 | 1f4m:A, 1f4m:C, 1f4m:E, 1f4n:B |
2 | 1yo7:A | 120 | 55 | 0.8036 | 0.3750 | 0.8182 | 2.44e-27 | 1yo7:B |
3 | 1yo7:A | 120 | 29 | 0.4286 | 0.2000 | 0.8276 | 1.24e-10 | 1yo7:B |
4 | 8spc:A | 370 | 48 | 0.3214 | 0.0486 | 0.3750 | 0.52 | 8spp:A |
5 | 5x51:M | 1386 | 56 | 0.3571 | 0.0144 | 0.3571 | 0.90 | 5x4z:A, 5x51:A, 8yfr:A |
6 | 5xon:A | 1427 | 42 | 0.2857 | 0.0112 | 0.3810 | 1.6 | 6a5l:A, 6a5o:A, 6a5p:A, 6a5r:A, 6a5t:A, 6a5u:A, 8h0v:A, 8h0w:A, 8he5:A, 6inq:A, 6ir9:A, 6j4w:A, 6j4x:A, 6j4y:A, 6j4z:A, 6j50:A, 6j51:A, 8jh2:A, 8jh3:A, 8jh4:A, 7wbv:A, 7wbw:A, 7wbx:A, 5x4z:M, 5x50:A, 7xn7:A, 5xog:A, 7xse:A, 7xsx:A, 7xsz:A, 7xt7:A, 7xtd:A, 7xti:A, 8yfq:A |
7 | 4kp4:A | 219 | 33 | 0.2321 | 0.0594 | 0.3939 | 2.3 | 1bxd:A |
8 | 8yon:C | 605 | 38 | 0.2500 | 0.0231 | 0.3684 | 4.5 | 9imj:A, 8ylu:C, 8ylu:D, 8yo1:C, 8yo1:D, 8yo7:D, 8yo7:C, 8yod:C, 8yod:D, 8yon:D |
9 | 6efn:A | 383 | 34 | 0.2143 | 0.0313 | 0.3529 | 9.1 | |
10 | 3h0g:M | 1476 | 22 | 0.1786 | 0.0068 | 0.4545 | 9.7 |