GTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQ
The query sequence (length=33) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1as4:B | 33 | 33 | 1.0000 | 1.0000 | 1.0000 | 3.70e-18 | |
2 | 6hgi:B | 35 | 32 | 0.8182 | 0.7714 | 0.8438 | 2.77e-12 | 6ftp:B, 6hgf:B, 6hgg:B, 6hgj:B, 6hgk:B, 6hgl:B, 5om2:B, 5om3:B, 5om7:B |
3 | 1hp7:A | 376 | 30 | 0.3939 | 0.0346 | 0.4333 | 1.44e-04 | 7ael:AAA, 7api:A, 8api:A, 9api:A, 6i4v:A, 1iz2:A, 7npl:A, 8pi2:A, 4pyw:A |
4 | 7npk:A | 352 | 30 | 0.3939 | 0.0369 | 0.4333 | 1.79e-04 | |
5 | 5hgc:A | 373 | 28 | 0.3636 | 0.0322 | 0.4286 | 0.003 | |
6 | 4c49:A | 367 | 29 | 0.3636 | 0.0327 | 0.4138 | 0.010 | 4bb2:A, 4bb2:B, 4c49:B, 4c49:C, 4c49:D, 2vdy:A, 2vdy:B |
7 | 1jmj:A | 397 | 35 | 0.4545 | 0.0378 | 0.4286 | 0.019 | |
8 | 1e03:L | 423 | 25 | 0.3636 | 0.0284 | 0.4800 | 0.049 | 1azx:I, 1azx:L, 2b5t:I, 1br8:I, 1e03:I, 3evj:I, 3evj:L, 2gd4:I, 2gd4:C, 1jvq:I, 3kcg:I, 1lk6:I, 1nq9:I, 1nq9:L, 1r1l:I, 1sr5:A, 1tb6:I |
9 | 2v95:A | 342 | 28 | 0.3030 | 0.0292 | 0.3571 | 0.12 | |
10 | 6los:A | 369 | 26 | 0.2727 | 0.0244 | 0.3462 | 0.18 | |
11 | 4zr1:B | 275 | 28 | 0.2727 | 0.0327 | 0.3214 | 0.33 | 4zr0:A, 4zr0:B, 4zr1:A |
12 | 8gxv:A | 353 | 29 | 0.2727 | 0.0255 | 0.3103 | 0.74 | |
13 | 4aqh:B | 383 | 25 | 0.2727 | 0.0235 | 0.3600 | 2.4 | 1a7c:A, 4aqh:A, 4aqh:C, 7aqf:A, 7aqg:A, 1dvm:A, 1dvm:C, 1dvm:D, 4g8o:D, 4g8r:A, 4g8r:B, 4ic0:A, 4ic0:C, 3q02:A, 3q02:B, 3q03:A, 3q03:B, 3r4l:A, 3ut3:B |
14 | 7rbw:A | 381 | 29 | 0.2121 | 0.0184 | 0.2414 | 3.9 | 7rbw:B |
15 | 4au2:C | 338 | 26 | 0.1818 | 0.0178 | 0.2308 | 5.4 | |
16 | 3zha:A | 380 | 26 | 0.1818 | 0.0158 | 0.2308 | 5.4 | 4au2:A, 4au2:B, 4au2:D, 4au3:A, 4au3:B, 4au3:C, 4au3:D, 7bdu:A, 7bdu:B, 7bee:A, 7bee:B, 7bfi:A, 7bfi:C, 7bfi:D, 7bfi:B, 3zha:B, 3zha:C, 3zha:D, 3zha:K, 3zha:L, 3zha:P, 3zha:Q |
17 | 2ihv:A | 563 | 21 | 0.2424 | 0.0142 | 0.3810 | 9.8 | 2iht:A, 2iht:B, 2iht:C, 2iht:D, 2ihu:A, 2ihu:B, 2ihu:C, 2ihu:D, 2ihv:B, 2ihv:C, 2ihv:D, 1upa:A, 1upa:B, 1upa:C, 1upa:D, 1upb:A, 1upb:B, 1upb:C, 1upb:D, 1upc:A, 1upc:B, 1upc:C, 1upc:D, 1upc:E, 1upc:F |