GTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFNKQAIQRLKAPAQMSIQLINK
AVNALINDQLIMKNHLRDIMCIPYCNYSKYWYLNHTTTGRTSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEY
MERQG
The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ejd:c | 165 | 165 | 1.0000 | 1.0000 | 1.0000 | 4.29e-126 | 9ck8:b, 8ejd:a, 8ejd:b, 6p95:a, 6p95:b, 6p95:c, 7sgf:a, 7sgf:b, 7sgf:c, 8tyc:b, 5vk2:b |
2 | 7nxd:B | 690 | 72 | 0.1333 | 0.0319 | 0.3056 | 3.0 | 7ceb:B, 7cec:B, 9ckv:B, 7nwl:B, 3vi3:B, 3vi3:D, 3vi4:D, 3vi4:B, 4wjk:B, 4wk0:B, 4wk2:B, 4wk4:B |
3 | 7mu2:C | 316 | 125 | 0.2061 | 0.1076 | 0.2720 | 3.5 | 7f69:A, 7mu2:A |
4 | 7zpq:CA | 1742 | 41 | 0.0788 | 0.0075 | 0.3171 | 4.2 | 7zrs:CA, 7zuw:CA |
5 | 2jam:B | 280 | 35 | 0.0788 | 0.0464 | 0.3714 | 5.3 | 2jam:A |
6 | 8hku:L22P | 150 | 25 | 0.0485 | 0.0533 | 0.3200 | 7.2 | 8hkv:L22P, 8hky:L22P, 8hkz:L22P, 8hl1:L22P, 8hl2:L22P, 8hl3:L22P, 8hl4:L22P, 8hl5:L22P |
7 | 2iyk:A | 155 | 19 | 0.0545 | 0.0581 | 0.4737 | 7.5 | 2iyk:B |
8 | 5iz4:A | 247 | 76 | 0.1273 | 0.0850 | 0.2763 | 7.9 | |
9 | 2wjy:A | 773 | 19 | 0.0545 | 0.0116 | 0.4737 | 8.6 | 2gjk:A, 2gk6:A, 2gk6:B, 2gk7:A, 8rxb:E, 8rxb:A, 8rxb:D, 8rxb:I, 8rxb:L, 8rxb:P, 2wjv:A, 2wjv:B, 2xzo:A |