BioLiP

>protein
GTDIISLSQAATKIHQAQQTLQSTPPISEENNDERTLARQQLTSSLNALAKSGVSLSAEQNENLRSAFSAPTSALFSIWD
MVSQNISAIGDSYLGVYENVVAVYTDFYQAFSDILSKMGGWLLPGKDGNTVKLDVTSLKNDLNSLVNKYNQINSNTVLFP
AQSGVKVATEAEARQWLSELNLPNSSLKSYGSGYVVTVDLTPLQKMVQDIDGLGAPGKDSKLEMDNAKYQAWQSGFKAQE
ENMKTTLQTLTQKYSNANSLYDNLVKVLSSTISSSLETAK

The query sequence (length=280) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3o01:A	283	282	0.9679	0.9576	0.9610	0.0	3o01:B, 3o02:A, 3o02:B
2	3zqe:B	248	199	0.6821	0.7702	0.9598	9.65e-136
3	3zqe:A	272	202	0.6857	0.7059	0.9505	4.53e-134	7agx:2F, 7agx:2K
4	8v5e:A	195	198	0.3357	0.4821	0.4747	2.33e-53	8v5c:B
5	3r9v:B	163	193	0.2571	0.4417	0.3731	2.17e-33
6	4lfl:B	172	56	0.0536	0.0872	0.2679	0.14	4lfl:D, 4lfm:B, 4lfm:D, 4lfn:B, 4lfn:D
7	3hqg:A	222	80	0.0821	0.1036	0.2875	0.94
8	3idu:A	116	74	0.0571	0.1379	0.2162	1.7	3idu:B
9	8ssl:A	1072	58	0.0821	0.0215	0.3966	1.7	5cjt:A, 5cjt:B, 5cju:A, 5cju:B, 5cjv:A, 5cjv:B, 5cjw:A, 5cjw:B, 8ssl:B, 8ssl:C, 4xc6:A, 4xc6:B, 4xc7:A, 4xc8:A, 4xc8:B
10	2o1s:A	536	130	0.1250	0.0653	0.2692	2.7	2o1s:C
11	2o1s:B	493	130	0.1250	0.0710	0.2692	3.2	2o1s:D
12	3l31:A	234	134	0.1286	0.1538	0.2687	4.4	3l2b:A, 3l2b:B, 3l31:B
13	6i8x:A	149	105	0.0821	0.1544	0.2190	6.8	6i8x:B
14	6il9:A	490	48	0.0571	0.0327	0.3333	8.7	6ila:A, 6ilb:A, 6ilb:D
15	8ki7:A	2003	65	0.0786	0.0110	0.3385	8.7
16	7fgx:D	563	34	0.0393	0.0195	0.3235	9.4	7fgw:A, 7fgw:B, 7fgw:C, 7fgw:D, 7fgx:A, 7fgx:B, 7fgx:C, 7fgy:A, 7fgy:B, 7fgy:C, 7fgy:D
17	8ki6:A	1580	65	0.0786	0.0139	0.3385	9.5
18	8ki8:A	1621	65	0.0786	0.0136	0.3385	9.6

[Back]