GTCALPSTYRWSSTGVLAQPKSGWVALKDFTTVTHNGRHLVYGSTSSGSSYGSMVFSPFTNWSDMASAGQNAMNQAAVAP
TLFYFAPKNIWVLAYQWGSWPFIYRTSSDPTDPNGWSAPQPLFTGSISGSDTGPIDQTLIADGQNMYLFFAGDNGKIYRA
SMPIGNFPGNFGSSYTTIMSDTKANLFEGVQVYKVQGQNQYLMIVEAMGANGRYFRSFTASSLSGSWTPQAASEGNPFAG
KANSGATWTNDISHGDLVRDNPDQTMTVDPCNLQFLYQGKSPNAGGDYNSLPWRPGVLTLRR
The query sequence (length=302) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3wmy:A | 302 | 302 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 3wmz:A, 3wn0:A, 3wn1:A, 3wn2:A |
2 | 4o8o:A | 303 | 303 | 0.7318 | 0.7294 | 0.7294 | 5.92e-165 | 4o8n:A, 4o8p:A |
3 | 6f1j:B | 302 | 299 | 0.7119 | 0.7119 | 0.7191 | 5.51e-164 | 6f1j:A |
4 | 5ubj:A | 303 | 302 | 0.6887 | 0.6865 | 0.6887 | 5.26e-154 | |
5 | 4n1i:A | 312 | 295 | 0.6556 | 0.6346 | 0.6712 | 1.19e-151 | 4n2r:A |
6 | 4n2z:A | 318 | 314 | 0.4007 | 0.3805 | 0.3854 | 8.59e-65 | |
7 | 4pvi:A | 328 | 324 | 0.3907 | 0.3598 | 0.3642 | 1.85e-57 | |
8 | 5joz:A | 507 | 220 | 0.1755 | 0.1045 | 0.2409 | 0.43 | 5joz:B |
9 | 7mmz:A | 559 | 97 | 0.0762 | 0.0411 | 0.2371 | 3.3 |