GTAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYV
VTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHC
SIPLRVGLPLLSPEFLLDGVLKQEAKPEAFVLSPLEMSST
The query sequence (length=200) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3k05:B | 200 | 200 | 1.0000 | 1.0000 | 1.0000 | 2.49e-146 | 2azm:A, 2azm:B, 3k05:A |
2 | 3sqd:A | 211 | 201 | 0.3200 | 0.3033 | 0.3184 | 8.81e-30 | 3sqd:B |
3 | 3l41:A | 214 | 195 | 0.2850 | 0.2664 | 0.2923 | 7.03e-18 | |
4 | 7p0l:A | 195 | 157 | 0.1800 | 0.1846 | 0.2293 | 3.92e-08 | 7p0l:B |
5 | 3szm:C | 191 | 174 | 0.2100 | 0.2199 | 0.2414 | 6.94e-05 | 3shv:A, 3shv:B, 3szm:A, 3szm:B, 3szm:D, 3szm:E, 3szm:F, 3szm:G, 3szm:H, 3t1n:A, 3t1n:B, 3u3z:A |
6 | 8ir2:B | 198 | 70 | 0.1100 | 0.1111 | 0.3143 | 0.005 | 8ir2:A, 8ir4:A, 8ir4:B |
7 | 5ecg:C | 227 | 160 | 0.2000 | 0.1762 | 0.2500 | 0.022 | 5ecg:D, 1gzh:D |
8 | 3al3:A | 218 | 45 | 0.0650 | 0.0596 | 0.2889 | 1.5 | 7cmz:A |
9 | 6a7i:A | 409 | 52 | 0.0750 | 0.0367 | 0.2885 | 4.9 | 6a7j:A |
10 | 1elj:A | 380 | 90 | 0.1300 | 0.0684 | 0.2889 | 5.6 | |
11 | 7thq:B | 505 | 27 | 0.0700 | 0.0277 | 0.5185 | 7.0 | 6o6e:B, 7thq:A |
12 | 8vzl:A | 646 | 83 | 0.1300 | 0.0402 | 0.3133 | 9.2 | 9bs3:A, 9bs3:E, 9bs4:A, 9bs4:E, 7kr3:A, 7kr4:A, 7l34:A, 7l35:A, 6p09:A, 6p0a:A, 6p0b:A, 6p0c:A, 6p0d:A, 6p0e:A, 6q1v:A, 7qnz:A, 7qo1:A, 7sum:A, 7sx5:A, 7sxe:A, 8vdn:A, 8vds:A, 8vdt:A, 8vzm:A, 1x9n:A |
13 | 6c0f:A | 394 | 38 | 0.0650 | 0.0330 | 0.3421 | 9.4 | 6cb1:A, 6em1:5, 6em3:5, 6em4:5, 7ohs:5, 7ohw:5, 7ohx:5, 8v83:I, 8v84:I, 5z3g:V |