BioLiP

>protein
GTAKKNLKATKKFEKKHLKGVLERRNKVKNKAAEMSVDDFFKGGFEILSSFRKLLKMLIKTVVAFWSQTDSTRITAFLVI
RRLVVIGKAVRETVLKASYQGLVQGCRVTNANTLSGINLMKNSAAELWGLDQNLGYTTAFTSIRQLAIHLRNSIINNKNQ
AYRNVYNWQYVHSLDFWSCVLSEHCSSPLRPLIYPLVQVTLGAMRLIPTAIYFPLRFHLIRSLLRLSRATDTYIPLASAL
LEVLQSAEMKKPPKSSTLKPLDFATAYKTPKSYLRTRVYQDGVGEQVVELLSEFFVLWSRNIAFPEFALPTIVALKRWMK
EMRKGNKNAKLGSSLVVLVQKLEMNAKFIEERRAKVDFAPKDRAQVDAFLKDLEWEKTPLGAYVVAQRKLREERKRLMEE
ARREEERKRR

The query sequence (length=410) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i9y:CY	420	420	1.0000	0.9762	0.9762	0.0	8i9x:CY, 8ia0:CY
2	8i9z:CY	382	409	0.8537	0.9162	0.8557	0.0
3	8e5t:6	514	424	0.4512	0.3599	0.4363	1.30e-116
4	8v87:8	477	486	0.4707	0.4046	0.3971	1.54e-113	7nac:8, 7nad:8, 7naf:8, 7r6k:8, 7r72:8, 7r7a:8
5	6hiv:Cv	1059	122	0.0780	0.0302	0.2623	1.3	6hiw:Cv, 6hiy:Cv, 7pub:Cv
6	4ntc:A	325	63	0.0561	0.0708	0.3651	2.5	4ntc:B
7	2ok0:H	216	107	0.0707	0.1343	0.2710	3.0
8	7aor:z	1071	123	0.0732	0.0280	0.2439	4.9
9	4y0k:A	405	95	0.0488	0.0494	0.2105	5.5	4y1b:A
10	2yd1:A	196	87	0.0707	0.1480	0.3333	7.1
11	6hzn:A	743	72	0.0439	0.0242	0.2500	8.4
12	7abg:W	162	118	0.0780	0.1975	0.2712	8.5	7abi:W, 9fmd:o, 8i0p:o, 8i0r:o, 6qdv:W, 6qx9:2A
13	1iru:G	245	96	0.0561	0.0939	0.2396	8.9	1iru:U

[Back]