GSVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLSKIKEVKPISQK
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3zj2:A | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 7.89e-49 | |
2 | 2vrd:A | 61 | 33 | 0.2394 | 0.2787 | 0.5152 | 0.085 | 4pjo:L, 4pjo:l, 4pjo:M, 4pjo:m, 6qx9:1C, 7vpx:N |
3 | 2lhn:A | 80 | 28 | 0.1690 | 0.1500 | 0.4286 | 0.36 | 5l2l:A, 5l2l:B, 5l2l:F, 5l2l:E |
4 | 2lhn:A | 80 | 17 | 0.1268 | 0.1125 | 0.5294 | 9.8 | 5l2l:A, 5l2l:B, 5l2l:F, 5l2l:E |
5 | 8w2o:B | 178 | 25 | 0.1831 | 0.0730 | 0.5200 | 1.1 | |
6 | 5h4r:A | 375 | 26 | 0.1549 | 0.0293 | 0.4231 | 1.4 | |
7 | 4lj0:A | 65 | 18 | 0.1408 | 0.1538 | 0.5556 | 4.5 | 4lj0:B |
8 | 2d9n:A | 77 | 30 | 0.1972 | 0.1818 | 0.4667 | 6.3 | 2rhk:C |
9 | 2xto:A | 224 | 63 | 0.2535 | 0.0804 | 0.2857 | 6.7 | 2xtm:A, 2xtm:B, 2xtn:A, 2xto:B |
10 | 1itk:B | 714 | 28 | 0.1408 | 0.0140 | 0.3571 | 7.5 | 1itk:A, 3uw8:A, 3uw8:B, 3vlh:A, 3vlh:B, 3vli:A, 3vli:B, 3vlj:A, 3vlj:B, 3vlk:A, 3vlk:B, 3vll:A, 3vll:B |
11 | 8a22:AJ | 122 | 56 | 0.1831 | 0.1066 | 0.2321 | 8.8 | 8apn:AJ, 8apo:AJ |