BioLiP

>protein
GSTSAMWACQHCTFMNQPGTGHCEMCSLPRT

The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1nj3:A	31	31	1.0000	1.0000	1.0000	3.75e-18	1q5w:A
2	3a9j:C	32	30	0.4516	0.4375	0.4667	4.13e-05	9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C
3	2crc:A	52	20	0.3548	0.2115	0.5500	0.012
4	8im5:A	66	20	0.3548	0.1667	0.5500	0.013	3b0a:E
5	7yui:B	232	24	0.3871	0.0517	0.5000	0.042	3b08:K, 3b08:B, 3b08:E, 3b08:H, 3b0a:B
6	2k1p:A	33	30	0.3226	0.3030	0.3333	0.045
7	2c6a:A	46	25	0.3226	0.2174	0.4000	0.44	2c6b:A, 4xxb:B
8	8pp6:K	36	25	0.2581	0.2222	0.3200	0.70
9	8hyj:C	285	24	0.3548	0.0386	0.4583	1.2
10	2ebq:A	47	24	0.2581	0.1702	0.3333	1.2	2gqe:A, 2k0c:A
11	7mo2:B	38	24	0.2581	0.2105	0.3333	1.2	3ch5:B, 7mo2:D
12	3mvd:L	394	16	0.2581	0.0203	0.5000	1.5	3mvd:K
13	2xsj:C	104	17	0.2581	0.0769	0.4706	1.9	2xsj:F
14	6i34:B	954	18	0.2258	0.0073	0.3889	2.0	6i33:A, 6i34:A, 6i34:C, 6i34:D, 6i35:A, 6i35:B, 6i35:C, 6i35:D
15	2d9g:A	53	22	0.2903	0.1698	0.4091	2.1
16	3or2:C	104	17	0.2581	0.0769	0.4706	2.5
17	5cd4:I	494	19	0.2903	0.0182	0.4737	3.3	5cd4:U, 5h9e:A, 5h9f:A, 4tvx:I, 4tvx:U, 4u7u:M
18	7mnr:B	40	24	0.2581	0.2000	0.3333	4.8
19	8ate:A	502	15	0.2258	0.0139	0.4667	8.8
20	2iya:A	392	13	0.2258	0.0179	0.5385	8.9	2iya:B

[Back]