GSSGSSGMPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHTFLCSKHFEASCFDLTGQTRRLKM
DAVPTIFDFCTHISGPSSG
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2d8r:A | 99 | 99 | 1.0000 | 1.0000 | 1.0000 | 9.83e-72 | |
2 | 2jtg:A | 87 | 81 | 0.3939 | 0.4483 | 0.4815 | 3.39e-20 | 2ko0:A, 2l1g:A |
3 | 2lau:A | 81 | 91 | 0.2727 | 0.3333 | 0.2967 | 4.99e-04 | |
4 | 1d9v:A | 309 | 53 | 0.1919 | 0.0615 | 0.3585 | 0.36 | 3kn7:A, 3kn8:A, 1mrp:A, 1nnf:A, 2o68:A, 3od7:A, 3odb:A |
5 | 9d8a:A | 172 | 46 | 0.1616 | 0.0930 | 0.3478 | 1.9 | |
6 | 2jm3:A | 91 | 63 | 0.1818 | 0.1978 | 0.2857 | 2.0 | |
7 | 6yxx:E1 | 473 | 27 | 0.1111 | 0.0233 | 0.4074 | 2.1 | |
8 | 7xh4:A | 177 | 40 | 0.1212 | 0.0678 | 0.3000 | 2.2 | 7xh2:A |
9 | 7d1b:A | 302 | 44 | 0.1616 | 0.0530 | 0.3636 | 2.7 | |
10 | 6xyc:A | 285 | 32 | 0.1010 | 0.0351 | 0.3125 | 3.2 | |
11 | 2yrt:A | 75 | 26 | 0.1212 | 0.1600 | 0.4615 | 4.7 | |
12 | 2aep:H | 143 | 48 | 0.1414 | 0.0979 | 0.2917 | 4.9 | |
13 | 2cs8:A | 108 | 45 | 0.1818 | 0.1667 | 0.4000 | 5.0 | |
14 | 1wem:A | 76 | 41 | 0.1414 | 0.1842 | 0.3415 | 5.2 | 4l7x:A, 2m3h:A |
15 | 3k4q:A | 438 | 61 | 0.1616 | 0.0365 | 0.2623 | 5.6 | 3k4q:B |
16 | 2dlk:A | 79 | 31 | 0.1313 | 0.1646 | 0.4194 | 5.6 | |
17 | 2yrc:A | 59 | 30 | 0.1111 | 0.1864 | 0.3667 | 6.3 | 2yrd:A |
18 | 2rsi:A | 92 | 31 | 0.1111 | 0.1196 | 0.3548 | 6.4 | 2elt:A, 2ruu:A, 2rv7:A |
19 | 2xf3:B | 428 | 10 | 0.0808 | 0.0187 | 0.8000 | 9.8 | 2xf3:A, 2xfs:A, 2xfs:B, 2xh9:A, 2xh9:B |
20 | 2dip:A | 98 | 38 | 0.1111 | 0.1122 | 0.2895 | 9.9 |