GSSGSSGMEPAGPCGFCPAGEVQPARYTCPRCNAPYCSLRCYRTHGTCAENFYSGPSSG
The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1x4s:A | 59 | 59 | 1.0000 | 1.0000 | 1.0000 | 3.34e-37 | |
2 | 2yqq:A | 56 | 60 | 0.4407 | 0.4643 | 0.4333 | 5.40e-07 | |
3 | 2n95:A | 49 | 37 | 0.2373 | 0.2857 | 0.3784 | 0.002 | |
4 | 2n94:A | 48 | 37 | 0.2712 | 0.3333 | 0.4324 | 0.007 | |
5 | 2d8q:A | 70 | 74 | 0.4576 | 0.3857 | 0.3649 | 0.012 | 2dan:A |
6 | 5ijl:A | 943 | 26 | 0.2034 | 0.0127 | 0.4615 | 0.11 | |
7 | 5ijl:A | 943 | 22 | 0.1525 | 0.0095 | 0.4091 | 2.1 | |
8 | 8ppt:B | 1191 | 26 | 0.2034 | 0.0101 | 0.4615 | 0.11 | 8ppu:B, 8ppv:B, 6t8h:B |
9 | 8ppt:B | 1191 | 22 | 0.1525 | 0.0076 | 0.4091 | 2.1 | 8ppu:B, 8ppv:B, 6t8h:B |
10 | 2e5r:A | 63 | 33 | 0.2203 | 0.2063 | 0.3939 | 0.23 | |
11 | 8x1c:L | 105 | 32 | 0.2542 | 0.1429 | 0.4688 | 0.43 | |
12 | 7zi4:R | 101 | 23 | 0.1864 | 0.1089 | 0.4783 | 0.77 | 6hts:R |
13 | 7ojl:L | 1498 | 17 | 0.1525 | 0.0060 | 0.5294 | 2.6 | |
14 | 7ojk:L | 1843 | 17 | 0.1525 | 0.0049 | 0.5294 | 2.6 | |
15 | 7ojn:L | 2010 | 17 | 0.1525 | 0.0045 | 0.5294 | 2.6 | 5j1n:A, 5j1p:A, 4miw:A, 7oe7:L |
16 | 2e72:A | 49 | 38 | 0.2881 | 0.3469 | 0.4474 | 3.1 | |
17 | 2ct7:A | 86 | 59 | 0.3390 | 0.2326 | 0.3390 | 3.1 | |
18 | 3o4p:A | 314 | 29 | 0.2203 | 0.0414 | 0.4483 | 3.6 | 3byc:A, 1e1a:A, 2gvu:A, 2gvv:A, 2gvw:A, 2gvx:A, 3hlh:A, 3hlh:B, 3hlh:C, 3hlh:D, 3hli:A, 3hli:B, 3hli:C, 3hli:D, 2iao:A, 2iap:A, 2iaq:A, 2iar:A, 2ias:A, 2iat:A, 2iau:A, 2iav:A, 2iaw:A, 2iax:A, 3kgg:A, 3li3:A, 3li4:A, 3li5:A, 1pjx:A |
19 | 2ea5:A | 68 | 68 | 0.4407 | 0.3824 | 0.3824 | 3.7 | |
20 | 1wii:A | 85 | 62 | 0.3559 | 0.2471 | 0.3387 | 3.8 | 8b3d:M, 8b3f:M |
21 | 7odf:A | 703 | 23 | 0.1356 | 0.0114 | 0.3478 | 3.8 | |
22 | 2epp:A | 66 | 19 | 0.2203 | 0.1970 | 0.6842 | 3.9 | |
23 | 6hiy:DA | 1426 | 12 | 0.1186 | 0.0049 | 0.5833 | 4.0 | |
24 | 7aor:aa | 1558 | 12 | 0.1186 | 0.0045 | 0.5833 | 4.1 | |
25 | 6hiv:DA | 1557 | 12 | 0.1186 | 0.0045 | 0.5833 | 4.1 | 6hiw:DA, 7pub:DA |
26 | 7ane:aa | 1514 | 12 | 0.1186 | 0.0046 | 0.5833 | 4.7 | |
27 | 7ena:2 | 385 | 13 | 0.1356 | 0.0208 | 0.6154 | 5.3 | 8bvw:4, 8byq:4, 8ebs:E, 8ebt:E, 8ebu:E, 8ebv:E, 8ebw:E, 8ebx:E, 8eby:E, 7egb:2, 7egc:2, 7enc:2, 8gxq:HG, 8gxs:HG, 7lbm:a, 7nvr:6, 7nvw:6, 7nvx:6, 7nvy:6, 7nvz:6, 7nw0:6, 6o9l:6, 6o9m:6, 8wak:2, 8wal:2, 8wan:2, 8wao:2, 8wap:2, 8waq:2, 8war:2, 8was:2, 1z60:A |
28 | 6fxr:A | 700 | 26 | 0.1695 | 0.0143 | 0.3846 | 5.4 | 6fxk:A, 6fxm:A, 6fxt:A, 6fxx:A, 6fxy:A, 8one:A, 6te3:A, 6tec:A, 6tes:A, 6teu:A, 6tex:A, 6tez:A, 6wfv:A |
29 | 2jun:A | 101 | 25 | 0.1695 | 0.0990 | 0.4000 | 6.9 | 2dq5:A |
30 | 6nmi:E | 366 | 13 | 0.1356 | 0.0219 | 0.6154 | 7.2 | |
31 | 7py4:B | 327 | 19 | 0.1356 | 0.0245 | 0.4211 | 7.7 | 6k7g:C, 6k7h:C, 6k7i:C, 6k7j:C, 6k7k:C, 6k7l:C, 6k7m:C, 6k7n:C, 6lkn:C |
32 | 5kkl:B | 839 | 28 | 0.2034 | 0.0143 | 0.4286 | 7.7 | |
33 | 6ryr:W | 708 | 18 | 0.1186 | 0.0099 | 0.3889 | 8.1 | 2l75:A, 1mm2:A, 6q3m:D, 6ryu:W, 6ryu:V |
34 | 2dj8:A | 60 | 64 | 0.4068 | 0.4000 | 0.3750 | 8.2 | |
35 | 6x67:C | 478 | 41 | 0.2034 | 0.0251 | 0.2927 | 8.2 | 5lme:A, 6x67:D, 6x68:C, 6x68:D |
36 | 2ffw:A | 78 | 32 | 0.2034 | 0.1538 | 0.3750 | 8.4 | |
37 | 6fu4:A | 297 | 25 | 0.1695 | 0.0337 | 0.4000 | 8.6 | 6fu4:B, 6fu4:C, 6fu4:D |
38 | 2jae:A | 478 | 23 | 0.1695 | 0.0209 | 0.4348 | 8.7 | 2jae:B, 2jb1:A, 2jb1:B, 2jb2:A, 2jb2:B, 2jb3:A, 2jb3:B |