GSSGSSGMEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPCLNSDFGCPFTMAR
NKVAEHLEMCPASVSGPSSG
The query sequence (length=100) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yre:A | 100 | 100 | 1.0000 | 1.0000 | 1.0000 | 1.95e-69 | |
2 | 1wjp:A | 107 | 63 | 0.2000 | 0.1869 | 0.3175 | 0.018 | |
3 | 2dip:A | 98 | 101 | 0.3200 | 0.3265 | 0.3168 | 0.22 | |
4 | 1x5w:A | 70 | 42 | 0.1300 | 0.1857 | 0.3095 | 2.1 | |
5 | 2yuc:A | 76 | 72 | 0.2000 | 0.2632 | 0.2778 | 3.0 | |
6 | 7o80:Bz | 595 | 34 | 0.1100 | 0.0185 | 0.3235 | 4.5 | 7a09:J, 6hcf:k1, 6hcm:k1, 3jag:jj, 3jah:jj, 3jai:jj, 5lzv:jj, 8p03:k, 8p09:k, 8scb:jj, 6yal:k, 6yam:k, 6zme:CI, 6zvj:1 |
7 | 2ep4:A | 74 | 73 | 0.2800 | 0.3784 | 0.3836 | 5.1 | |
8 | 3k1l:A | 376 | 80 | 0.2500 | 0.0665 | 0.3125 | 5.3 | 3k1l:B |
9 | 3cyr:A | 107 | 30 | 0.1200 | 0.1121 | 0.4000 | 6.3 | 1gm4:A, 1gmb:A, 2kmy:A, 2ksu:A, 1up9:A, 1upd:A |
10 | 1i77:A | 107 | 33 | 0.1100 | 0.1028 | 0.3333 | 7.3 |