GSSGSSGMALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEK
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yrt:A | 75 | 75 | 1.0000 | 1.0000 | 1.0000 | 8.27e-53 | |
2 | 2xcm:E | 74 | 63 | 0.4133 | 0.4189 | 0.4921 | 1.26e-19 | 2xcm:F |
3 | 2d8r:A | 99 | 26 | 0.1600 | 0.1212 | 0.4615 | 3.6 | |
4 | 1dgj:A | 906 | 24 | 0.1467 | 0.0121 | 0.4583 | 4.4 | |
5 | 7w93:A | 307 | 17 | 0.1200 | 0.0293 | 0.5294 | 4.8 | 7vsk:A, 7vte:A, 7vte:B, 7vte:C, 7vte:D, 7vtf:A, 7vtf:B, 7vtf:C, 7vtf:D, 7vtg:A, 7vtg:B, 7vtg:C, 7vtg:D, 7vva:A, 7vva:B, 7vva:C, 7vva:D |
6 | 5z5a:A | 148 | 20 | 0.1333 | 0.0676 | 0.5000 | 5.9 | 5z5a:B, 5z5a:C |
7 | 2eln:A | 38 | 17 | 0.1467 | 0.2895 | 0.6471 | 8.6 | 2ruz:A |
8 | 2bht:A | 294 | 72 | 0.2667 | 0.0680 | 0.2778 | 9.5 | 2bhs:A, 2bhs:B, 2bhs:C, 2bhs:D, 2bht:B, 2bht:C, 2bht:D, 2jc3:A, 2jc3:H, 2jc3:B, 2jc3:C, 2jc3:D, 2jc3:E, 2jc3:F, 2jc3:G, 2v03:A |
9 | 3sig:A | 265 | 14 | 0.1200 | 0.0340 | 0.6429 | 9.9 | 3sii:A |