BioLiP

>protein
GSSGSSGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESSGPSSG

The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2yuc:A	76	76	1.0000	1.0000	1.0000	9.52e-52
2	2d9k:A	75	77	0.3947	0.4000	0.3896	1.81e-05
3	3hcs:A	157	62	0.2368	0.1146	0.2903	1.72e-04	3hcs:B, 3hct:A, 3hcu:A, 3hcu:C, 8hz2:A, 8hz2:B, 2jmd:A, 7l3l:B, 7l3l:D
4	5vo0:D	159	60	0.2632	0.1258	0.3333	0.001	5vnz:A, 5vnz:D, 5vo0:A
5	2d9h:A	78	85	0.4079	0.3974	0.3647	0.019
6	2eod:A	66	25	0.1447	0.1667	0.4400	0.24
7	2eod:A	66	27	0.1184	0.1364	0.3333	6.7
8	1wjv:A	79	86	0.3684	0.3544	0.3256	0.28
9	2yre:A	100	72	0.2632	0.2000	0.2778	2.3
10	7wtb:B	1147	63	0.2763	0.0183	0.3333	2.8	3bg3:A, 3bg3:B, 3bg3:C, 3bg3:D, 3bg9:A, 3bg9:B, 3bg9:C, 3bg9:D, 8j7o:A, 8j7o:B, 8j7o:C, 8j7o:E, 7wta:C, 7wta:B, 7wta:D, 7wta:A, 7wtb:C, 7wtb:A, 7wtb:D, 7wtc:C, 7wtc:A, 7wtc:B, 7wtc:D, 7wtd:C, 7wtd:D, 7wte:C, 7wte:D
11	8hwl:A	941	63	0.2763	0.0223	0.3333	3.3	8hwl:B, 8hwl:C, 8hwl:E
12	8fru:b	57	11	0.1053	0.1404	0.7273	4.5	8br8:Lc, 8brm:Lc, 8bsi:Lc, 8bsj:Lc, 8btd:Lc, 8btr:Lc, 7pwg:b, 7pwo:b2
13	2rpc:A	155	65	0.2895	0.1419	0.3385	5.1	2ej4:A
14	2dq7:X	263	33	0.1447	0.0418	0.3333	7.1
15	1a0r:B	339	25	0.1316	0.0295	0.4000	7.3	7e9h:B, 8jd6:B, 6rmv:A, 7tmw:B, 1xhm:A
16	1x5w:A	70	77	0.3421	0.3714	0.3377	7.7
17	5eku:B	347	18	0.1053	0.0231	0.4444	9.3	5eku:A, 4m37:A, 4m38:A, 4m38:B

[Back]