GSSGSSGHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGSGPSSG
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2d9k:A | 75 | 75 | 1.0000 | 1.0000 | 1.0000 | 1.62e-49 | |
2 | 2yuc:A | 76 | 77 | 0.4000 | 0.3947 | 0.3896 | 1.78e-05 | |
3 | 2yqm:A | 89 | 72 | 0.3200 | 0.2697 | 0.3333 | 0.59 | 2yw8:A |
4 | 2epu:A | 45 | 31 | 0.1867 | 0.3111 | 0.4516 | 1.8 | |
5 | 5e6m:A | 519 | 29 | 0.2133 | 0.0308 | 0.5517 | 1.8 | 4kr2:A, 4kr3:A |
6 | 2yqq:A | 56 | 76 | 0.3200 | 0.4286 | 0.3158 | 7.4 | |
7 | 6bza:C | 501 | 26 | 0.1467 | 0.0220 | 0.4231 | 7.8 | 6bza:A, 6bza:B, 6bzn:D, 6bzq:A, 6bzq:B, 6bzq:C, 6bzq:D, 6bzt:A, 6bzt:B, 6bzt:C, 6bzt:D, 6bzz:A, 6bzz:B, 6bzz:C, 6bzz:D |