GSSGSSGFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHN
KKRHRHSESGPSSG
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yu4:A | 94 | 94 | 1.0000 | 1.0000 | 1.0000 | 1.74e-66 | |
2 | 7qcd:C | 267 | 69 | 0.2021 | 0.0712 | 0.2754 | 1.57e-04 | 3htk:C |
3 | 7p47:A | 187 | 69 | 0.2021 | 0.1016 | 0.2754 | 2.02e-04 | |
4 | 2ct1:A | 77 | 96 | 0.3298 | 0.4026 | 0.3229 | 0.010 | |
5 | 8pjn:b | 296 | 49 | 0.1809 | 0.0574 | 0.3469 | 0.024 | |
6 | 2ecw:A | 85 | 44 | 0.1702 | 0.1882 | 0.3636 | 0.11 | |
7 | 8v83:Z | 253 | 36 | 0.1383 | 0.0514 | 0.3611 | 0.23 | 6c0f:v, 8v84:Z |
8 | 8v83:Z | 253 | 29 | 0.1170 | 0.0435 | 0.3793 | 4.6 | 6c0f:v, 8v84:Z |
9 | 2dmi:A | 115 | 35 | 0.1383 | 0.1130 | 0.3714 | 1.1 | |
10 | 6u75:A | 261 | 80 | 0.2447 | 0.0881 | 0.2875 | 2.2 | 6u75:B |
11 | 6wi7:A | 206 | 42 | 0.1383 | 0.0631 | 0.3095 | 3.2 | 2ckl:A, 8grm:M, 2h0d:A, 7nd1:H, 8pp7:K, 8pp7:M, 4r8p:K, 4r8p:M, 3rpg:B, 6wi8:A, 6wi8:B |
12 | 7jzv:A | 253 | 43 | 0.1383 | 0.0514 | 0.3023 | 3.6 | 8grq:K, 1jm7:A, 7lyb:M |
13 | 4r8p:L | 254 | 39 | 0.1277 | 0.0472 | 0.3077 | 4.4 | 2ckl:B, 8grm:N, 2h0d:B, 7nd1:A, 8pp7:L, 8pp7:N, 4r8p:N, 3rpg:C, 4s3o:B, 4s3o:E |
14 | 5f93:B | 426 | 26 | 0.1170 | 0.0258 | 0.4231 | 4.5 | 5f7m:A, 5f7m:B, 5f7n:A, 5f7n:B, 5f7w:A, 5f7w:B, 5f7y:A, 5f7y:B, 5f8r:A, 5f8r:B, 5f93:A, 5f93:E, 5f93:G, 5f97:A, 5f97:B, 5f97:C, 5f97:D, 5f9a:A, 5f9d:A |
15 | 6l8n:A | 810 | 49 | 0.1702 | 0.0198 | 0.3265 | 4.5 | |
16 | 7ajt:CM | 360 | 45 | 0.1383 | 0.0361 | 0.2889 | 5.3 | 7aju:CM, 7d4i:RK, 7d5s:RK, 7d5t:RK, 7d63:RK, 6ke6:RK, 6lqp:RK, 6lqq:RK, 6lqr:RK, 6lqs:RK, 6lqt:RK, 6lqu:RK, 6lqv:RK, 7suk:SH, 5wlc:SH, 6zqa:CM, 6zqb:CM, 6zqc:CM, 6zqd:CM, 6zqe:CM, 6zqg:CM |
17 | 3e3r:A | 183 | 26 | 0.0957 | 0.0492 | 0.3462 | 6.7 | 3e3r:B |
18 | 2dlq:A | 124 | 71 | 0.2021 | 0.1532 | 0.2676 | 6.9 | |
19 | 6thq:B | 301 | 33 | 0.1170 | 0.0365 | 0.3333 | 7.4 | 5ce8:A, 5ce8:B, 5ce8:C, 6thq:A, 6thq:C |
20 | 8cx0:B | 176 | 41 | 0.1277 | 0.0682 | 0.2927 | 8.9 | 8cx1:B, 8cx1:G, 8cx2:B, 8cx2:G |
21 | 2elx:A | 35 | 22 | 0.0851 | 0.2286 | 0.3636 | 9.0 | 2rv5:A |