GSSGSSGEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFASGPSS
G
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2dlo:A | 81 | 81 | 1.0000 | 1.0000 | 1.0000 | 3.21e-56 | |
2 | 1x3h:A | 80 | 82 | 0.3951 | 0.4000 | 0.3902 | 4.59e-11 | |
3 | 2d8x:A | 70 | 81 | 0.3951 | 0.4571 | 0.3951 | 8.97e-11 | |
4 | 2ehe:A | 82 | 84 | 0.4568 | 0.4512 | 0.4405 | 6.98e-10 | |
5 | 2dj7:A | 80 | 82 | 0.3951 | 0.4000 | 0.3902 | 1.17e-09 | |
6 | 2cur:A | 69 | 81 | 0.3704 | 0.4348 | 0.3704 | 1.01e-08 | |
7 | 2dar:A | 90 | 91 | 0.4074 | 0.3667 | 0.3626 | 1.10e-08 | |
8 | 1v6g:A | 81 | 86 | 0.3951 | 0.3951 | 0.3721 | 3.26e-07 | |
9 | 2d8z:A | 70 | 81 | 0.3580 | 0.4143 | 0.3580 | 4.58e-07 | |
10 | 1x63:A | 82 | 83 | 0.3704 | 0.3659 | 0.3614 | 4.81e-07 | |
11 | 2cuq:A | 80 | 82 | 0.3827 | 0.3875 | 0.3780 | 6.18e-07 | |
12 | 1x4k:A | 72 | 83 | 0.3333 | 0.3750 | 0.3253 | 8.33e-06 | |
13 | 1wyh:A | 72 | 54 | 0.2593 | 0.2917 | 0.3889 | 1.66e-05 | |
14 | 2rgt:B | 154 | 60 | 0.2716 | 0.1429 | 0.3667 | 1.77e-05 | 2rgt:A |
15 | 2rgt:B | 154 | 57 | 0.2716 | 0.1429 | 0.3860 | 0.003 | 2rgt:A |
16 | 2jtn:A | 182 | 60 | 0.2716 | 0.1209 | 0.3667 | 1.91e-05 | |
17 | 2jtn:A | 182 | 58 | 0.2716 | 0.1209 | 0.3793 | 0.003 | |
18 | 6cme:A | 154 | 63 | 0.2469 | 0.1299 | 0.3175 | 2.29e-05 | 6cme:B, 3mmk:A, 3mmk:B |
19 | 6cme:A | 154 | 57 | 0.2346 | 0.1234 | 0.3333 | 0.002 | 6cme:B, 3mmk:A, 3mmk:B |
20 | 2cor:A | 79 | 84 | 0.3580 | 0.3671 | 0.3452 | 1.09e-04 | |
21 | 2d8y:A | 91 | 93 | 0.3580 | 0.3187 | 0.3118 | 1.92e-04 | |
22 | 1wig:A | 73 | 66 | 0.2963 | 0.3288 | 0.3636 | 2.92e-04 | |
23 | 6u4m:A | 65 | 57 | 0.2222 | 0.2769 | 0.3158 | 5.42e-04 | 6u4n:B |
24 | 2egq:A | 77 | 72 | 0.3210 | 0.3377 | 0.3611 | 7.43e-04 | |
25 | 1x64:A | 89 | 91 | 0.3580 | 0.3258 | 0.3187 | 7.73e-04 | |
26 | 7qb0:A | 127 | 61 | 0.2222 | 0.1417 | 0.2951 | 0.001 | |
27 | 7qb0:A | 127 | 57 | 0.1975 | 0.1260 | 0.2807 | 0.008 | |
28 | 4jcj:C | 150 | 37 | 0.2222 | 0.1200 | 0.4865 | 0.005 | 4jcj:A, 4jcj:B |
29 | 7lt9:B | 131 | 36 | 0.1728 | 0.1069 | 0.3889 | 0.005 | 7d2s:B, 7d2t:B, 7d2t:D, 7d2u:B, 1nyp:A, 1u5s:B |
30 | 7lt9:B | 131 | 34 | 0.1358 | 0.0840 | 0.3235 | 6.2 | 7d2s:B, 7d2t:B, 7d2t:D, 7d2u:B, 1nyp:A, 1u5s:B |
31 | 3f6q:B | 72 | 64 | 0.2346 | 0.2639 | 0.2969 | 0.006 | 4hi8:B, 4hi9:B |
32 | 2mbv:A | 96 | 36 | 0.1852 | 0.1562 | 0.4167 | 0.007 | |
33 | 2dfy:X | 158 | 36 | 0.1852 | 0.0949 | 0.4167 | 0.007 | 2dfy:C, 1rut:X |
34 | 3ixe:B | 70 | 64 | 0.2346 | 0.2714 | 0.2969 | 0.009 | |
35 | 2o10:A | 60 | 59 | 0.1852 | 0.2500 | 0.2542 | 0.011 | |
36 | 1g47:A | 70 | 64 | 0.2346 | 0.2714 | 0.2969 | 0.014 | 2kbx:B |
37 | 1b8t:A | 192 | 52 | 0.1852 | 0.0781 | 0.2885 | 0.015 | 1ctl:A |
38 | 1b8t:A | 192 | 59 | 0.1975 | 0.0833 | 0.2712 | 0.076 | 1ctl:A |
39 | 1x62:A | 79 | 69 | 0.2963 | 0.3038 | 0.3478 | 0.016 | |
40 | 1a7i:A | 60 | 60 | 0.1728 | 0.2333 | 0.2333 | 0.022 | |
41 | 1x61:A | 72 | 50 | 0.2099 | 0.2361 | 0.3400 | 0.048 | |
42 | 2o13:A | 58 | 60 | 0.1852 | 0.2586 | 0.2500 | 0.068 | |
43 | 2lxd:A | 123 | 56 | 0.1975 | 0.1301 | 0.2857 | 0.096 | 2l6y:B, 2l6z:C |
44 | 2co8:A | 82 | 84 | 0.3333 | 0.3293 | 0.3214 | 0.12 | |
45 | 8f5o:B | 1134 | 34 | 0.1358 | 0.0097 | 0.3235 | 0.29 | 8f5p:B |
46 | 4kfz:B | 148 | 56 | 0.1975 | 0.1081 | 0.2857 | 0.50 | 4kfz:A, 2xjy:A, 2xjz:A, 2xjz:B, 2xjz:C, 2xjz:D, 2xjz:E, 2ypa:C |
47 | 2dmi:A | 115 | 60 | 0.2222 | 0.1565 | 0.3000 | 1.5 | |
48 | 6mif:A | 79 | 34 | 0.1358 | 0.1392 | 0.3235 | 2.0 | |
49 | 2ct2:A | 88 | 90 | 0.3333 | 0.3068 | 0.3000 | 2.0 | 5fey:A, 5fey:B |
50 | 8uy2:D | 557 | 38 | 0.1975 | 0.0287 | 0.4211 | 2.0 | 8uy2:A, 8uy2:B, 8uy2:C |
51 | 8uy1:A | 598 | 38 | 0.1975 | 0.0268 | 0.4211 | 2.1 | 8uy1:D, 8uy1:B, 8uy1:C |
52 | 2d8q:A | 70 | 81 | 0.3210 | 0.3714 | 0.3210 | 3.0 | 2dan:A |
53 | 2miu:A | 98 | 60 | 0.1975 | 0.1633 | 0.2667 | 3.8 | |
54 | 6nus:A | 715 | 21 | 0.0864 | 0.0098 | 0.3333 | 4.4 | |
55 | 8j5u:A | 534 | 31 | 0.1728 | 0.0262 | 0.4516 | 4.4 | 8j5q:A, 8j5s:A |
56 | 8gwe:A | 931 | 21 | 0.0864 | 0.0075 | 0.3333 | 5.8 | 7aap:A, 7b3b:A, 7b3c:A, 7b3d:A, 7btf:A, 7bv1:A, 7bv2:A, 7bw4:A, 7bzf:A, 7c2k:A, 7ctt:A, 7cxm:A, 7cxn:A, 7cyq:A, 7d4f:A, 7dfg:A, 7dfh:A, 7doi:A, 7dok:A, 7dte:A, 7ed5:A, 7egq:A, 7egq:N, 7eiz:A, 8gw1:A, 8gwb:A, 8gwf:A, 8gwg:A, 8gwi:A, 8gwk:A, 8gwm:A, 8gwn:A, 8gwo:A, 8gy6:A, 7krn:A, 7kro:A, 7krp:A, 7l1f:A, 6nur:A, 7oyg:A, 7oyg:D, 7ozu:A, 7ozv:A, 7rdx:A, 7rdy:A, 7rdz:A, 7re0:A, 7re1:A, 7re2:A, 7re3:A, 7re3:G, 8sq9:A, 8sqj:A, 8sqk:A, 7uo4:A, 7uo7:A, 7uo9:A, 7uob:A, 7uoe:A, 6xez:A, 6xqb:A, 6yyt:A |
57 | 7thm:A | 860 | 21 | 0.0864 | 0.0081 | 0.3333 | 6.0 | |
58 | 8xrt:F | 751 | 37 | 0.1358 | 0.0146 | 0.2973 | 6.8 | 8xrt:E, 8xrt:A, 8xrt:B, 8xrt:C, 8xrt:D, 8xru:A, 8xru:B, 8xrv:A, 8xrv:B, 8xrv:C, 8xrv:F, 8xrv:D, 8xrv:E, 8xrx:A, 8xrx:D, 8xrx:F, 8xrx:B, 8xrx:C |
59 | 6f1c:A | 291 | 27 | 0.1235 | 0.0344 | 0.3704 | 7.2 | 6f1c:C, 6f1d:A, 6f1h:A, 6f1h:C, 6f39:A, 6f39:B |
60 | 8xrx:E | 611 | 37 | 0.1358 | 0.0180 | 0.2973 | 8.0 |