BioLiP

>protein
GSSGSSGCSEVNVVKERPKTDEHKSYSCSFKGCTDVELVAVICPYCEKNFCLRHRHQSDHDCEKLEVAKPRMAATQKLVR
SGPSSG

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1wfe:A	86	86	1.0000	1.0000	1.0000	4.85e-60
2	7y7l:A	45	41	0.4070	0.7778	0.8537	4.56e-21
3	1wys:A	75	86	0.3256	0.3733	0.3256	3.53e-09
4	1x4v:A	63	59	0.2558	0.3492	0.3729	9.49e-08
5	1wff:A	85	86	0.3256	0.3294	0.3256	0.005
6	2ct7:A	86	94	0.3372	0.3372	0.3085	0.005
7	2dja:A	84	89	0.3372	0.3452	0.3258	0.091
8	5ij4:A	49	33	0.1279	0.2245	0.3333	0.091
9	7yab:A	44	38	0.1279	0.2500	0.2895	0.48
10	1wg2:A	64	70	0.2558	0.3438	0.3143	1.2
11	3anl:A	400	19	0.1163	0.0250	0.5263	1.4	3anl:B, 3anm:A, 3anm:B, 3ann:A, 3ann:B, 2egh:A, 2egh:B, 1jvs:A, 1jvs:B, 1ono:A, 1ono:B, 1onp:A, 1onp:B, 1q0h:A, 1q0l:A, 1q0q:A, 1q0q:B, 3r0i:A, 3r0i:B, 1t1r:A, 1t1r:B, 1t1s:A, 1t1s:B
12	1wfp:A	74	71	0.2558	0.2973	0.3099	2.4
13	1wim:A	94	100	0.3953	0.3617	0.3400	2.9	6l99:A
14	7s0m:B	305	25	0.0930	0.0262	0.3200	3.0	7s0m:A
15	6sc6:A	365	33	0.1279	0.0301	0.3333	3.1	5edv:A, 5edv:B, 6gzy:A, 6gzy:B, 6kc5:B, 6kc6:A, 6kc6:C, 6kc6:E, 6kc6:G, 6kc6:I, 6kc6:K, 4ljo:A, 4ljp:A, 4ljq:B, 4ljq:C, 4ljq:A, 4ljq:D, 6sc5:A, 6sc7:A, 6sc8:A, 6sc9:A, 7v8f:B, 7v8g:D, 7v8g:C
16	2eod:A	66	38	0.1279	0.1667	0.2895	4.1
17	7ste:A	468	31	0.1512	0.0278	0.4194	5.0	8fs4:A, 7sh2:A
18	7yx4:A	650	21	0.1163	0.0154	0.4762	5.1	7ptv:A, 7ptv:B, 7yx4:B, 7yx5:A
19	1o4t:A	115	24	0.1279	0.0957	0.4583	7.9	1o4t:B
20	5hj7:B	260	34	0.1279	0.0423	0.3235	8.2	5hj7:A

[Back]