GSSANDWQCKTCSNVNWARRSECNMCNTPKYAK
The query sequence (length=33) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2k1p:A | 33 | 33 | 1.0000 | 1.0000 | 1.0000 | 5.97e-19 | |
2 | 6g99:B | 41 | 29 | 0.4545 | 0.3659 | 0.5172 | 0.001 | |
3 | 1n0z:A | 45 | 30 | 0.4545 | 0.3333 | 0.5000 | 0.004 | |
4 | 2mxv:A | 43 | 25 | 0.3333 | 0.2558 | 0.4400 | 0.022 | |
5 | 1nj3:A | 31 | 30 | 0.3030 | 0.3226 | 0.3333 | 0.048 | 1q5w:A |
6 | 2crc:A | 52 | 21 | 0.2727 | 0.1731 | 0.4286 | 0.29 | |
7 | 5m3k:E | 145 | 21 | 0.2424 | 0.0552 | 0.3810 | 0.34 | 5m3k:B, 5mg5:B, 5mg5:E, 5mg5:H, 5mg5:K, 5mg5:N, 5mg5:Q, 5mg5:T, 5mg5:W |
8 | 8im5:A | 66 | 20 | 0.2727 | 0.1364 | 0.4500 | 0.36 | 3b0a:E |
9 | 3a9j:C | 32 | 31 | 0.2424 | 0.2500 | 0.2581 | 1.3 | 9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C |
10 | 6uca:D | 416 | 24 | 0.2727 | 0.0216 | 0.3750 | 1.5 | 6uca:A, 6uca:B, 6uca:C, 6uca:E, 6uca:F |
11 | 7yui:B | 232 | 20 | 0.2727 | 0.0388 | 0.4500 | 2.2 | 3b08:K, 3b08:B, 3b08:E, 3b08:H, 3b0a:B |
12 | 7mo2:B | 38 | 24 | 0.3030 | 0.2632 | 0.4167 | 2.7 | 3ch5:B, 7mo2:D |
13 | 2c6a:A | 46 | 25 | 0.3030 | 0.2174 | 0.4000 | 4.1 | 2c6b:A, 4xxb:B |
14 | 2ebq:A | 47 | 24 | 0.3030 | 0.2128 | 0.4167 | 5.7 | 2gqe:A, 2k0c:A |
15 | 6esq:H | 128 | 19 | 0.2424 | 0.0625 | 0.4211 | 6.8 | 6et9:E, 6et9:F, 6et9:G, 6et9:H |