GSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCESNLRSSVANN
The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2glo:A | 59 | 59 | 1.0000 | 1.0000 | 1.0000 | 6.66e-40 | |
2 | 6zu5:LJ0 | 168 | 49 | 0.2373 | 0.0833 | 0.2857 | 1.6 | |
3 | 6c3a:A | 378 | 50 | 0.2542 | 0.0397 | 0.3000 | 1.8 | 6c3a:B, 6c3c:A, 6c3c:B, 6c3d:A, 6c3d:B |
4 | 3rqi:A | 170 | 20 | 0.1864 | 0.0647 | 0.5500 | 1.9 | |
5 | 7scd:A | 371 | 47 | 0.1864 | 0.0296 | 0.2340 | 6.2 | 3bd9:A, 7sce:A |
6 | 5e7g:A | 446 | 57 | 0.2542 | 0.0336 | 0.2632 | 9.0 | |
7 | 7sl9:A | 497 | 23 | 0.0847 | 0.0101 | 0.2174 | 9.5 |