BioLiP

>protein
GSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWF

The query sequence (length=33) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8dd5:A	272	32	0.9697	0.1176	1.0000	4.14e-17	1m36:A, 2ozu:A, 2rc4:A
2	7d0p:A	276	31	0.6667	0.0797	0.7097	2.92e-10	7d0o:A, 7d0q:A, 7d0r:A, 7d0s:A, 5gk9:A, 6maj:A, 6mak:A
3	2ou2:A	246	30	0.5455	0.0732	0.6000	6.33e-06
4	5wci:A	284	28	0.4545	0.0528	0.5357	9.56e-05	6ba2:A, 6ba4:A, 7cmr:A, 6ct2:A, 4dnc:A, 4dnc:B, 2giv:A, 5j8c:A, 5j8f:A, 6oin:A, 6oio:A, 6oip:A, 6oiq:A, 6oir:A, 6owh:A, 6owi:A, 6pd8:A, 6pd9:A, 6pda:A, 6pdb:A, 6pdc:A, 6pdd:A, 6pde:A, 6pdf:A, 6pdg:A, 2pq8:A, 3qah:A, 3toa:A, 3tob:A, 8w13:A, 2y0m:A
5	6d50:B	840	31	0.3636	0.0143	0.3871	0.72	6d50:A, 6nzg:A, 6nzg:B, 5uj6:A, 5uj6:B
6	2elr:A	36	21	0.2727	0.2500	0.4286	0.97	2rv3:A
7	2l1o:A	37	24	0.2727	0.2432	0.3750	1.1
8	2rsj:A	92	23	0.2727	0.0978	0.3913	2.5	2els:A, 2rut:A, 2rv6:A
9	2elx:A	35	29	0.3030	0.2857	0.3448	2.7	2rv5:A
10	6u4m:A	65	24	0.2727	0.1385	0.3750	3.6	6u4n:B
11	2bco:A	338	19	0.2727	0.0266	0.4737	4.0	2bco:B
12	8hfr:ox	143	21	0.2424	0.0559	0.3810	4.7	6ft6:I, 3jct:I, 6m62:I, 6n8j:I, 6n8k:I, 6n8l:I, 7ug6:I, 7uoo:I, 7uqb:I, 7uqz:I, 7v08:I, 6ylg:I, 6ylh:I, 6yly:I, 7z34:I
13	6e93:A	112	21	0.2727	0.0804	0.4286	7.0	6e94:A
14	6sga:FJ	353	20	0.2424	0.0227	0.4000	7.4	6sg9:FJ, 6sgb:FJ

[Back]