GSRATVFKLGLFKSLFLCSFHDITRLFKNDKTTNQQWVLAVFGLAEVFFEASFELLKKQCSFLQMQKRSHEGGTCAVYLI
CFNTAKSRETVRNLMANMLNVREECLMLQPPKIRGLSAALFWFKSSLSPATLKHGALPEWIRAQTTLN
The query sequence (length=148) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7apd:G | 152 | 148 | 1.0000 | 0.9737 | 1.0000 | 5.15e-109 | 7apd:H, 1ksx:A, 1ksx:B, 1ksx:E, 1ksx:F, 1ksx:I, 1ksx:J, 1ksx:M, 1ksx:N, 1ksy:A, 1ksy:B, 1ksy:C |
2 | 3srj:A | 298 | 73 | 0.1216 | 0.0604 | 0.2466 | 1.8 | 3sri:A, 3srj:B, 4z09:A, 4z0d:A, 4z0e:A, 4z0f:A |
3 | 7qv7:A | 174 | 31 | 0.0743 | 0.0632 | 0.3548 | 4.9 | 7qv7:G |