BioLiP

>protein
GSQVDAEGNPFWEISDKRRVGISQFKKMDFINIREYYEAGGEMKPGKKGIGLTVDQYTAFLKAIPAINAELRSRGHDIT

The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5zg9:A	83	79	1.0000	0.9518	1.0000	3.48e-55	4bhm:A, 4bhm:D, 4bhm:B, 4bhm:F, 4bhm:C
2	6ycs:C	68	63	0.3038	0.3529	0.3810	5.26e-08	2c62:A, 2c62:B, 2phe:A, 2phe:B, 4usg:A, 4usg:B, 6ycs:A, 6ycs:B, 6ycs:D
3	7jrl:A	457	33	0.1646	0.0284	0.3939	0.80	7jrm:A
4	4bg4:A	356	26	0.1392	0.0309	0.4231	1.1	4bg4:B, 4bhl:A
5	3f29:B	520	43	0.1772	0.0269	0.3256	1.1	3d1i:A, 3d1i:B, 3f29:A, 3fo3:A, 3fo3:B, 3gm6:A, 3gm6:B, 4l38:A, 4l38:B, 4l3x:A, 4l3x:B, 4l3y:A, 4l3y:B, 4l3z:A, 4l3z:B, 3lg1:A, 3lg1:B, 3lgq:A, 3lgq:B, 3mmo:A, 3mmo:B, 2ot4:A, 2ot4:B, 3owm:A, 3owm:B, 4q0t:A, 4q0t:B, 4q17:A, 4q17:B, 4q1o:A, 4q1o:B, 4q4u:A, 4q4u:B, 4q5b:A, 4q5b:B, 4q5c:A, 4q5c:B, 3rkh:A, 3rkh:B, 3s7w:A, 3s7w:B, 3sce:A, 3sce:B, 3uu9:A, 3uu9:B, 2zo5:A, 2zo5:B
6	7byd:A	276	40	0.1772	0.0507	0.3500	2.4	7byd:F, 6iwg:A, 6iwh:A, 6lt6:A
7	5npz:A	277	40	0.1392	0.0397	0.2750	2.8	6kwk:A, 6kwl:A, 6lf8:A, 5nq0:A, 5nq1:A, 5nq1:D, 5nq3:A, 5nq3:D, 3qq3:A, 3qq3:D, 3qq4:A, 5ylx:A
8	6m7y:A	952	38	0.1646	0.0137	0.3421	3.1	6m7y:B
9	3ly0:B	352	27	0.1266	0.0284	0.3704	4.0	3fdg:A, 3fdg:B, 3ly0:A
10	5b5l:A	207	68	0.1899	0.0725	0.2206	5.2	5b5s:A
11	8b57:A	485	45	0.2025	0.0330	0.3556	8.4	8bbx:A, 8bbx:B, 7wab:A
12	6aee:A	275	34	0.1266	0.0364	0.2941	9.3	6aee:D, 2d31:A, 2d31:D, 2dyp:A, 6k60:A, 6k60:E, 3kyn:A, 3kyo:A, 3kyo:C, 1ydp:A
13	1bg0:A	356	26	0.1139	0.0253	0.3462	9.4	4gvy:A, 4gvz:A, 4gw0:A, 4gw2:A, 5j99:A, 5j9a:A, 1m15:A, 1p50:A, 1p52:A, 1rl9:A, 1sd0:A
14	5cr9:A	290	21	0.1266	0.0345	0.4762	9.8

[Back]