GSQLKRLKASLREQGLIGPQKSKKQKRQNANDQKAEALKSIREQFNPFQFKTNARGPKFEVTTNVIKGRPELSRARSEEK
RRQTILVEMQRRNKVGGIIDRRTEEEKAAEAAKKLQELEEKRLKRMRGKERLGNFSQVLIHHIAYLGDRFQPHWFPTLEQ
LSRHVHSLAKTFPIEVAKAYRMRIQEMEEHRPLAPTVGDLVILTAIGTTFPTSDHFHQVCTPAMLAIARYLGQKVPAALS
DFAVGIYLSILALQYQDFAKRYVPEMMNFLLNTLCALAPERAKSKLGNFPVHEPPAGIRIKDATNTPIRQLNCGDCLRKD
ELSPAETSSLQIAILSTATAILKSAADTWHKLPAFIESFQPALSVAQHLLTKPNASHLPSSLTSKLNDLASHLSRLLQLS
RLSRRPLELHHHRPLAIKTYIPKFDPDKHYDPNRERAELAKLKAEHKRERKGALRELRKDAQFIRREQLRIKKEKDEAYE
KKFKRIIAEIQNEEGRAANEYAREKAAR
The query sequence (length=508) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6rxt:UB | 512 | 512 | 1.0000 | 0.9922 | 0.9922 | 0.0 | 5oql:B, 6rxu:UB, 6rxv:UB, 6rxx:UB, 6rxy:UB, 6rxz:UB |
2 | 7d5s:RN | 607 | 406 | 0.2461 | 0.2059 | 0.3079 | 1.16e-46 | 7ajt:UB, 7aju:UB, 7d4i:RN, 7d5t:RN, 7d63:RN, 6ke6:RN, 6lqp:RN, 6lqq:RN, 6lqr:RN, 6lqs:RN, 6lqt:RN, 6lqu:RN, 6lqv:RN, 6zqb:UB, 6zqc:UB, 6zqd:UB, 6zqg:UB |
3 | 7d5s:RN | 607 | 196 | 0.1004 | 0.0840 | 0.2602 | 8.11e-09 | 7ajt:UB, 7aju:UB, 7d4i:RN, 7d5t:RN, 7d63:RN, 6ke6:RN, 6lqp:RN, 6lqq:RN, 6lqr:RN, 6lqs:RN, 6lqt:RN, 6lqu:RN, 6lqv:RN, 6zqb:UB, 6zqc:UB, 6zqd:UB, 6zqg:UB |
4 | 7suk:ST | 599 | 405 | 0.2461 | 0.2087 | 0.3086 | 2.98e-46 | 5wlc:ST |
5 | 7suk:ST | 599 | 100 | 0.0650 | 0.0551 | 0.3300 | 1.09e-05 | 5wlc:ST |
6 | 6zqa:UB | 504 | 441 | 0.2480 | 0.2500 | 0.2857 | 1.34e-42 | 6zqf:UB |
7 | 7mqa:ST | 570 | 364 | 0.2008 | 0.1789 | 0.2802 | 3.94e-32 | 7mq8:ST, 7mq9:ST |
8 | 7mqa:ST | 570 | 59 | 0.0433 | 0.0386 | 0.3729 | 0.15 | 7mq8:ST, 7mq9:ST |
9 | 5ffc:A | 148 | 68 | 0.0472 | 0.1622 | 0.3529 | 5.9 | 5fej:A, 5fej:B, 5fej:C, 5fej:D, 5ffd:A, 5ffe:A, 5ffe:B |
10 | 6thh:C | 816 | 71 | 0.0394 | 0.0245 | 0.2817 | 9.1 | 6yes:A |
11 | 5cvn:B | 321 | 71 | 0.0413 | 0.0654 | 0.2958 | 9.5 | 5cvo:B, 5cvo:E, 6jlq:A |
12 | 6cin:B | 1169 | 57 | 0.0295 | 0.0128 | 0.2632 | 9.6 | 6cin:A, 6cin:C, 6cin:D, 6cin:E, 6cin:F, 6cio:A, 6cio:B, 6cio:C, 6cio:D, 6cio:E, 6cio:F, 6cip:A, 6cip:B, 6cip:C, 6cip:D, 6cip:E, 6cip:F, 6ciq:A, 6ciq:B, 6ciq:C |