BioLiP

>protein
GSPLAQQIKNILSLISQADAAGRMDEVRTLQLNLCQLMVEYFQGSPLAQQIKNIHSFGHQAWAAGRLDEVLTIQENLYQL
MKEYFQQS

The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7bww:A	90	89	1.0000	0.9778	0.9888	8.10e-60	7bww:B, 7bww:C, 7bww:D, 6ypi:A
2	5od9:A	95	94	0.7273	0.6737	0.6809	5.83e-36	5od1:A, 5od9:B
3	3v1d:A	48	45	0.4318	0.7917	0.8444	6.54e-22	3v1c:A, 3v1c:B, 3v1d:F, 3v1d:B, 3v1d:C, 3v1d:E, 3v1d:H, 3v1d:D, 3v1d:G, 3v1e:A, 3v1e:B, 3v1f:A, 3v1f:B
4	3v1d:A	48	45	0.4205	0.7708	0.8222	6.96e-19	3v1c:A, 3v1c:B, 3v1d:F, 3v1d:B, 3v1d:C, 3v1d:E, 3v1d:H, 3v1d:D, 3v1d:G, 3v1e:A, 3v1e:B, 3v1f:A, 3v1f:B
5	4uzs:A	687	19	0.1023	0.0131	0.4737	1.8	4ucf:A, 4ucf:B, 4ucf:C, 4uzs:B
6	6ggo:A	199	37	0.1364	0.0603	0.3243	5.0	6ggo:B
7	7k7m:B	757	55	0.2159	0.0251	0.3455	5.5	7k7m:A, 7n6b:A
8	6aji:A	873	55	0.2159	0.0218	0.3455	5.5
9	6ajf:A	901	55	0.2159	0.0211	0.3455	5.8	6ajg:A, 6ajh:A, 6ajj:A, 7c2m:A, 7c2n:A, 6or2:A, 7wnx:A
10	1gxo:A	320	35	0.1364	0.0375	0.3429	7.1
11	2bbr:A	189	31	0.1591	0.0741	0.4516	7.4
12	2ebf:X	711	80	0.1932	0.0239	0.2125	8.3	2ebh:X
13	8cd1:h	129	29	0.1136	0.0775	0.3448	9.3	6spc:h, 6spe:h, 6spf:h, 6spg:h, 7unr:h, 7unu:h, 7unv:h, 7unw:h

[Back]