BioLiP

>protein
GSMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRAKKSGLRV

The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2jyd:A	46	46	1.0000	1.0000	1.0000	2.92e-28
2	2mf8:A	75	37	0.8043	0.4933	1.0000	2.17e-21	2jx1:A
3	2mf8:A	75	33	0.6522	0.4000	0.9091	8.78e-16	2jx1:A
4	1pxe:A	48	31	0.4783	0.4583	0.7097	9.87e-12
5	2cs8:A	108	41	0.5217	0.2222	0.5854	5.38e-11
6	2cs8:A	108	26	0.3478	0.1481	0.6154	4.00e-07
7	1e1d:A	553	24	0.2174	0.0181	0.4167	3.0	1e2u:A, 1e9v:A, 1gnt:A, 1oa1:A, 1w9m:A
8	4v8p:BC	409	38	0.2391	0.0269	0.2895	3.6	4v8p:CC, 4v8p:EC, 4v8p:GC
9	8dyu:A	2562	14	0.1739	0.0031	0.5714	4.1	8dyv:A
10	8fcy:A	2864	14	0.1739	0.0028	0.5714	4.1	8fd6:A, 8fdt:A
11	8pqw:A	2892	14	0.1739	0.0028	0.5714	4.1	8pqy:A, 8pqz:A, 8pqz:J
12	5nug:A	2920	14	0.1739	0.0027	0.5714	4.1	5nug:B
13	7z8g:A	3047	14	0.1739	0.0026	0.5714	4.1	8fdu:A, 7z8l:f
14	8ptk:f	4502	14	0.1739	0.0018	0.5714	4.1	8ptk:e
15	7z8f:e	4579	14	0.1739	0.0017	0.5714	4.1	5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A
16	7ep0:A	250	13	0.1957	0.0360	0.6923	5.1	7ep0:B, 7yc2:C, 7yc2:A, 7yc2:B, 7yc2:D
17	2eln:A	38	11	0.1957	0.2368	0.8182	6.0	2ruz:A
18	4tx6:B	310	20	0.1957	0.0290	0.4500	7.4	4tx6:A, 2xtk:A, 2xtk:B, 2xuc:A, 2xuc:B, 2xuc:C, 2xvn:A, 2xvn:B

[Back]