GSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKY
LEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKL
QFPTLRNSRLRTLINQSLN
The query sequence (length=179) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5nqv:C | 190 | 179 | 1.0000 | 0.9421 | 1.0000 | 7.95e-129 | 5nqv:A, 5nqv:B, 5nqv:D |
2 | 5c7e:C | 206 | 179 | 0.9218 | 0.8010 | 0.9218 | 7.07e-118 | 5c6q:A, 5c6v:A, 5c6v:B, 5c6v:C, 5c6v:D, 5c7e:A, 5c7e:B, 5c7e:D, 5c7e:E, 5c7e:F, 5c7f:A, 5c7f:B, 5c7f:C, 5c7f:D, 5j9k:A, 5j9k:B, 5ja5:A, 5jgc:A, 5jhp:A |
3 | 7wek:B | 262 | 87 | 0.1732 | 0.1183 | 0.3563 | 1.01e-04 | 7wek:A |
4 | 5en7:A | 177 | 60 | 0.1061 | 0.1073 | 0.3167 | 0.011 | 5en6:A, 5en7:C, 5en7:E, 5en7:G |
5 | 8hw1:A | 241 | 54 | 0.1061 | 0.0788 | 0.3519 | 1.4 | 8hw1:K, 8hw1:B, 8hw1:C, 8hw1:D, 8hw1:E, 8hw1:F, 8hw1:G, 8hw1:H, 8hw1:I, 8hw1:J |
6 | 2ve3:A | 435 | 21 | 0.0559 | 0.0230 | 0.4762 | 6.8 | 2ve3:B, 2ve4:A, 2ve4:B |
7 | 3mco:A | 397 | 42 | 0.0894 | 0.0403 | 0.3810 | 7.9 | 3mcn:B, 3mco:B |
8 | 5vo3:A | 380 | 90 | 0.1453 | 0.0684 | 0.2889 | 9.4 | 3ic1:A, 3ic1:B, 3isz:A, 3isz:B |