GSLELERVMSSLLDMGFSNAHINELLSVRRGASLQQLLDIISEFILLGLNPEPVCVVLKKSPQLLKLPIMQMRKRSSYLQ
KLGLGEGKLKRVLYCCPEIFTMRQQDINDTVRLLKEKCLFTVQQVTKILHSCPSVLREDLGQLEYKFQYAYFRMGIKHPD
IVKSEYLQYSLTKIKQRHIYLERLGRYQTPDKKGQTQIPNPLLKDILRVSEAEFLARTACTSVEEFQVFKKLLAREEEES
ESST
The query sequence (length=244) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7pd3:y | 245 | 244 | 1.0000 | 0.9959 | 1.0000 | 1.52e-180 | 7o9k:A2, 7o9m:A2, 7odr:y, 7ods:y, 7odt:y, 7of0:G, 7of3:G, 7of5:G, 7of7:G, 7oic:y, 8pk0:y, 8qsj:y |
2 | 8bx8:C | 3947 | 49 | 0.0738 | 0.0046 | 0.3673 | 2.0 | 7k58:C, 7k5b:C, 7kek:C |
3 | 2wkw:A | 315 | 83 | 0.0738 | 0.0571 | 0.2169 | 2.5 | 2wkw:B |
4 | 8scd:A | 264 | 87 | 0.0943 | 0.0871 | 0.2644 | 2.7 | 7s2m:A, 7s2m:B, 7s2m:C |
5 | 6k4d:A | 539 | 63 | 0.0738 | 0.0334 | 0.2857 | 3.9 | 6k4c:A |
6 | 2i9u:A | 419 | 77 | 0.0984 | 0.0573 | 0.3117 | 5.2 | 2i9u:B |